LXL04_010514 | RubberDandelionOmics

Gene overview

LXL04_010514

Reference: OH-1004 Chr: Chr02 Coordinates: 148142437-148143969 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1533 bp · LXL04_010514|LXL04_010514|OH1004|cDNA

ATGATCTTTCTTCTTCGAAGAAAACAGTCTTTCAAATCAATCCTCACTAAACCAATCCACTTTTTGTCCAACGAATCAAAACATCACATTTTTCCACCACTCCTTTCCCTTAAACCCTCACAAAACCCCCAATTTAACAATCCTAGGGTTTCATCATTCAAACCCCTTTCCACCCAATCCTCCAAATTCCCCGAATATGAAATGCCAACAGTGACATGGGGCGTTGTGCAAGGCCGAAAGGAAAAACTCGTATCCCGAGT...

CDS

Download CDS FASTA

1533 bp · LXL04_010514|LXL04_010514|OH1004|CDS

ATGATCTTTCTTCTTCGAAGAAAACAGTCTTTCAAATCAATCCTCACTAAACCAATCCACTTTTTGTCCAACGAATCAAAACATCACATTTTTCCACCACTCCTTTCCCTTAAACCCTCACAAAACCCCCAATTTAACAATCCTAGGGTTTCATCATTCAAACCCCTTTCCACCCAATCCTCCAAATTCCCCGAATATGAAATGCCAACAGTGACATGGGGCGTTGTGCAAGGCCGAAAGGAAAAACTCGTATCCCGAGT...

Protein

Download Protein FASTA

510 aa · LXL04_010514|LXL04_010514|OH1004|PROTEIN

MIFLLRRKQSFKSILTKPIHFLSNESKHHIFPPLLSLKPSQNPQFNNPRVSSFKPLSTQSSKFPEYEMPTVTWGVVQGRKEKLVSRVIICDYLKSIGIIPDELENLELPSTVDVMRERVEFLQKIGLTIDDFNEYPLMLGCSVRKNIIPVLGYLEKVGIQRSRMGEFVKKYPQVLHASVVVELVPVIRFLRGLDVERQDIGYVLMKYPELLGFKLEGTMSTSVAYLVSIGVNPRDIGPMVTQYPYFLGMRVGTMIKPLVE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010514`
TK1151 ID	TkA03G358090
OH-1004 ID	LXL04_010514
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	40.900
Protein coverage (%)	TK1151 9.841 / OH-1004 12.941 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010514

Location Chr02:148142437-148143969 (+)

Description Similar to MTERF4: Transcription termination factor MTERF4, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g02990`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release
`At2g21710`	Transcription termination factor involved in processing of plastid transcripts (By similarity).	No verified direct reference in this release
`At4g38160`	Transcription termination factor essential for chloroplast development.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0404000`	Transcription termination factor required for processing and steady-state levels of plastid transcripts.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010514 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006353 DNA-templated transcription termination Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0032502 developmental process Biological Process

GO:0042254 ribosome biogenesis Biological Process

GO:0042793 plastid transcription Biological Process

GO:0042794 plastid rRNA transcription Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT2G21710

ath:AT4G02990

dosa:Os05g0404000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.661

Rank 1 · LXL04_010514 · OH-1004

Plastid0.259

Rank 2 · LXL04_010514 · OH-1004

Nucleus0.060

Rank 3 · LXL04_010514 · OH-1004

Cytoplasm0.037

Rank 4 · LXL04_010514 · OH-1004

Cell membrane0.013

Rank 5 · LXL04_010514 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02536.20mTERF151-459 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010514	`PF02536.20`	mTERF	151	459	3.2e-112	375.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZT96`	Arabidopsis thaliana	Transcription termination factor MTERF4, chloroplastic	54.987%	Swiss-Prot	strong database homology
`F4IHL3`	Arabidopsis thaliana	Transcription termination factor MTERF2, chloroplastic	26.562%	Swiss-Prot	weak database homology
`Q9SZL6`	Arabidopsis thaliana	Transcription termination factor MTERF6, chloroplastic/mitochondrial	26.642%	Swiss-Prot	weak database homology
`Q6AUK6`	Oryza sativa subsp. japonica	Transcription termination factor MTERF4, chloroplastic	53.197%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card