LXL04_010305 | RubberDandelionOmics

Gene overview

LXL04_010305

Reference: OH-1004 Chr: Chr02 Coordinates: 143936830-143942062 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1947 bp · LXL04_010305|LXL04_010305|OH1004|cDNA

ATGTCTGGTGACGGAAGAGGTACAGTGGTGATGAAGGTCTGGCGGGTGAGGTTTGGTGACAATAGATATCCCATATTGGTCTTGAAGGAAGAACCTGACCCCAAAAGGGTCGTGACCAAAGTGAACCTGCCCCTCAGCGGGTTCGACAACGTACGGTTAGCTGGTCACTATGGCTCCGACATAACCGATGGTGTCAAATGGTTGTTCAAGCTTGTCTGTATCATCACCGGAGTTACTGTTTCTAATTACCCACCACTAAC...

CDS

Download CDS FASTA

1947 bp · LXL04_010305|LXL04_010305|OH1004|CDS

ATGTCTGGTGACGGAAGAGGTACAGTGGTGATGAAGGTCTGGCGGGTGAGGTTTGGTGACAATAGATATCCCATATTGGTCTTGAAGGAAGAACCTGACCCCAAAAGGGTCGTGACCAAAGTGAACCTGCCCCTCAGCGGGTTCGACAACGTACGGTTAGCTGGTCACTATGGCTCCGACATAACCGATGGTGTCAAATGGTTGTTCAAGCTTGTCTGTATCATCACCGGAGTTACTGTTTCTAATTACCCACCACTAAC...

Protein

Download Protein FASTA

648 aa · LXL04_010305|LXL04_010305|OH1004|PROTEIN

MSGDGRGTVVMKVWRVRFGDNRYPILVLKEEPDPKRVVTKVNLPLSGFDNVRLAGHYGSDITDGVKWLFKLVCIITGVTVSNYPPLTTVMMDVKVLEPTTTTTTVYPSHQPFTVDHILPLSHLDTDRNMNVPFRYVRAYAAADHQNADPFDVITTALSTALVKFYAYTGSLHRRKSDGRFELHCKVGTGVPVISATVDSPLSSVNYLDDADEEFIELLVPNPDQEARLTHVLILQVTRFSCGGYTLGAAVHHALSDGMGA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_010305`
TK1151 ID	TkA03G244420
OH-1004 ID	LXL04_010305
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.200
Protein coverage (%)	TK1151 76.577 / OH-1004 10.494 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_010305

Location Chr02:143936830-143942062 (-)

Description Similar to SCT: Spermidine coumaroyl-CoA acyltransferase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g25150`	Spermidine coumaroyl-CoA acyltransferase that mediates the conversion of spermidine into dicoumaroyl-spermidine.	A novel polyamine acyltransferase responsible for the accumulation of spermidine conjugates in Arabidopsis seed.2009 · DOI: 10.1105/tpc.108.063511

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010305 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009821 alkaloid biosynthetic process Biological Process

GO:0016407 acetyltransferase activity Molecular Function

KEGG gene cross-reference

lang:109328823

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.433

Rank 1 · LXL04_010305 · OH-1004

Nucleus0.316

Rank 2 · LXL04_010305 · OH-1004

Endoplasmic reticulum0.148

Rank 3 · LXL04_010305 · OH-1004

Cell membrane0.124

Rank 4 · LXL04_010305 · OH-1004

Plastid0.093

Rank 5 · LXL04_010305 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02458.21Transferase99-361 aa

PF02458.21Transferase388-642 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_010305	`PF02458.21`	Transferase	99	361	3.6e-67	227.6
LXL04_010305	`PF02458.21`	Transferase	388	642	3.6e-67	227.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GYW8`	Arabidopsis thaliana	Spermidine coumaroyl-CoA acyltransferase	35.317%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card