LXL04_009454 | RubberDandelionOmics

Gene overview

LXL04_009454

Reference: OH-1004 Chr: Chr02 Coordinates: 126800016-126803802 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2502 bp · LXL04_009454|LXL04_009454|OH1004|cDNA

ATGGAGGAAACGATGGGAAGGTTACCACGTTTGGAGGATATTCCGGAGTTGATCCACCATATACAATTGTTGTTGCCGACAAAAGAAGCCGCCCGTACAAGCATCTTATCCAAGTCATGGTTGTACGCTTGGTCAACCATCCCTACCCTCAAGTTATCTGTTACCAAAGATCAAGAAAAGATGGTCGACTGCATTCTGATAAGATATCTCCGTGACGACATCCCAATCGAAAGTTTTGACTTCAAGATCGATATTGAGAA...

CDS

Download CDS FASTA

2502 bp · LXL04_009454|LXL04_009454|OH1004|CDS

ATGGAGGAAACGATGGGAAGGTTACCACGTTTGGAGGATATTCCGGAGTTGATCCACCATATACAATTGTTGTTGCCGACAAAAGAAGCCGCCCGTACAAGCATCTTATCCAAGTCATGGTTGTACGCTTGGTCAACCATCCCTACCCTCAAGTTATCTGTTACCAAAGATCAAGAAAAGATGGTCGACTGCATTCTGATAAGATATCTCCGTGACGACATCCCAATCGAAAGTTTTGACTTCAAGATCGATATTGAGAA...

Protein

Download Protein FASTA

833 aa · LXL04_009454|LXL04_009454|OH1004|PROTEIN

MEETMGRLPRLEDIPELIHHIQLLLPTKEAARTSILSKSWLYAWSTIPTLKLSVTKDQEKMVDCILIRYLRDDIPIESFDFKIDIENQELASHAIKWIRPVVIKTCLTKLFLEIMVTNDSFMLPDEILFSKNLNIVRIYCTSNVHFIWMSSRPVINSVSLRELDLKHVYIREKVLDDIFSTCCLLEKIKLIDCKGFKTIKVKNLCSLYELAVVSDESDGSVLEIDHVPKLRLFSCDIRFVTLPANPLTFNLVTQLSLGGD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_009454`
TK1151 ID	TkA08G198820
OH-1004 ID	LXL04_009454
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	61.600
Protein coverage (%)	TK1151 100.000 / OH-1004 22.209 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_009454

Location Chr02:126800016-126803802 (+)

Description Similar to At5g03100: F-box protein At5g03100

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g03100`	F-box protein At5g03100.	No verified direct reference in this release
`At5g02700`	Putative F-box/LRR-repeat protein At5g02700.	No verified direct reference in this release
`At4g03220`	Putative F-box/FBD/LRR-repeat protein At4g03220.	No verified direct reference in this release
`At3g28410`	Putative F-box/LRR-repeat protein At3g28410.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009454 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT3G28410

ath:AT4G03220

ath:AT5G02700

ath:AT5G03100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.759

Rank 1 · LXL04_009454 · OH-1004

Cytoplasm0.229

Rank 2 · LXL04_009454 · OH-1004

Cell membrane0.067

Rank 3 · LXL04_009454 · OH-1004

Endoplasmic reticulum0.043

Rank 4 · LXL04_009454 · OH-1004

Plastid0.020

Rank 5 · LXL04_009454 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF188-235 aa

PF24758.2LRR_At5g56370108-213 aa

PF13966.12zf-RVT647-732 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_009454	`PF23622.2`	LRR_At1g61320_AtMIF1	88	235	4.3e-10	40.2
LXL04_009454	`PF24758.2`	LRR_At5g56370	108	213	4e-10	40.4
LXL04_009454	`PF13966.12`	zf-RVT	647	732	9.4e-19	68.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q501G5`	Arabidopsis thaliana	F-box protein At5g03100	25.316%	Swiss-Prot	weak database homology
`Q9LZ15`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At5g02700	22.483%	Swiss-Prot	weak database homology
`Q9ZR09`	Arabidopsis thaliana	Putative F-box/FBD/LRR-repeat protein At4g03220	28.689%	Swiss-Prot	weak database homology
`Q9LSJ3`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein At3g28410	22.408%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card