LXL04_007867 | RubberDandelionOmics

Gene overview

LXL04_007867

Reference: OH-1004 Chr: Chr02 Coordinates: 68293655-68298111 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1413 bp · LXL04_007867|LXL04_007867|OH1004|cDNA

ATGTATAAACTCAAACATTCAGACGACGGATATTTGACACGTTTAGCTGGTTTTCTTAAAGCTGCTGAGGGAAATCGTGTGGAAAAGGGAGAAAGCTACATATGGTGTCCTTGTGTAGATTGCAAAAATGGTCAAAAGTCGGTTTATGTCAAAGTAGAAGAACATTTAATATTTCGTGGGTTTATGCCTGATTATATATGTTGGTCAAGACATGGTGAGATGATGGTTGGGCGTACTGAGATTCACTTGGATTTTAATGG...

CDS

Download CDS FASTA

1413 bp · LXL04_007867|LXL04_007867|OH1004|CDS

ATGTATAAACTCAAACATTCAGACGACGGATATTTGACACGTTTAGCTGGTTTTCTTAAAGCTGCTGAGGGAAATCGTGTGGAAAAGGGAGAAAGCTACATATGGTGTCCTTGTGTAGATTGCAAAAATGGTCAAAAGTCGGTTTATGTCAAAGTAGAAGAACATTTAATATTTCGTGGGTTTATGCCTGATTATATATGTTGGTCAAGACATGGTGAGATGATGGTTGGGCGTACTGAGATTCACTTGGATTTTAATGG...

Protein

Download Protein FASTA

470 aa · LXL04_007867|LXL04_007867|OH1004|PROTEIN

MYKLKHSDDGYLTRLAGFLKAAEGNRVEKGESYIWCPCVDCKNGQKSVYVKVEEHLIFRGFMPDYICWSRHGEMMVGRTEIHLDFNGDNDDLNNENCDNLSGMLHDCEYDFANEDYDKFQELFDESEKPLYDGCTKYTKLSANEIKADDIGFPAKGGHRRRARASKNFVLNSGTERWISHYEGDRPRGRGAVEVYSGEGNHKRLSHTAGMVYKSVLKARFLSLRDQGFPIWLKYVPGMAFRTDNGPFKNAMERFTLRIVN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007867`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007867

Location Chr02:68293655-68298111 (+)

Description Similar to Beta-galactosidase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26140`	Beta-galactosidase 12.	No verified direct reference in this release
`At5g56870`	Preferentially hydrolyzes para-nitrophenyl-beta-D- galactoside.	Functional genomic analysis of Arabidopsis thaliana glycoside hydrolase family 35.2007 · DOI: 10.1016/j.phytochem.2007.03.021
`At3g13750`	Beta-galactosidase 1.	No verified direct reference in this release
`At3g52840`	Beta-galactosidase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007867 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009536 plastid Cellular Component

GO:0048046 apoplast Cellular Component

GO:0099503 secretory vesicle Cellular Component

GO:0004565 beta-galactosidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G13750

ath:AT3G52840

ath:AT4G26140

ath:AT5G56870

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.373

Rank 1 · LXL04_007867 · OH-1004

Nucleus0.336

Rank 2 · LXL04_007867 · OH-1004

Mitochondrion0.098

Rank 3 · LXL04_007867 · OH-1004

Extracellular0.096

Rank 4 · LXL04_007867 · OH-1004

Endoplasmic reticulum0.073

Rank 5 · LXL04_007867 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13963.12Transpos_assoc1-73 aa

PF01301.26Glyco_hydro_35227-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007867	`PF13963.12`	Transpos_assoc	1	73	2.4e-17	63.6
LXL04_007867	`PF01301.26`	Glyco_hydro_35	227	354	1.1e-26	94.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SCV0`	Arabidopsis thaliana	Beta-galactosidase 12	74.194%	Swiss-Prot	weak database homology
`Q9SCV8`	Arabidopsis thaliana	Beta-galactosidase 4	73.387%	Swiss-Prot	weak database homology
`Q9SCW1`	Arabidopsis thaliana	Beta-galactosidase 1	69.355%	Swiss-Prot	weak database homology
`Q9LFA6`	Arabidopsis thaliana	Beta-galactosidase 2	72.581%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card