LXL04_007847 | RubberDandelionOmics

Gene overview

LXL04_007847

Reference: OH-1004 Chr: Chr02 Coordinates: 66239252-66245860 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1761 bp · LXL04_007847|LXL04_007847|OH1004|cDNA

atggaagatgtggttgtagaaaatccttcaagatcttttgagaactcatatattcccgagaacccgagaactcccaaaccgttaactttttcgaaaaaccgacttcggggggctaaaaatcgctcaaatttaaggctggtcgcaaaaaaaaatttccgaaaaaacaacttttttttcaaaaagtttgcatatatgcaaaaaaaaaattcgtgcatatgcataagtctttataccacatatttaaagggttttgttaaaaa...

CDS

Download CDS FASTA

1761 bp · LXL04_007847|LXL04_007847|OH1004|CDS

ATGGAAGATGTGGTTGTAGAAAATCCTTCAAGATCTTTTGAGAACTCATATATTCCCGAGAACCCGAGAACTCCCAAACCGTTAACTTTTTCGAAAAACCGACTTCGGGGGGCTAAAAATCGCTCAAATTTAAGGCTGGTCGCAAAAAAAAATTTCCGAAAAAACAACTTTTTTTTCAAAAAGTTTGCATATATGCAAAAAAAAAATTCGTGCATATGCATAAGTCTTTATACCACATATTTAAAGGGTTTTGTTAAAAA...

Protein

Download Protein FASTA

586 aa · LXL04_007847|LXL04_007847|OH1004|PROTEIN

MEDVVVENPSRSFENSYIPENPRTPKPLTFSKNRLRGAKNRSNLRLVAKKNFRKNNFFFKKFAYMQKKNSCICISLYTTYLKGFVKKNLKKNAKKKVAYMQKLKKKVAYMQKLKKNIRILFILNVLEGSKVGFLKGITLLSTLARFDSISNAAKSAACTASKMVGFPSLYLPISSLWKSIRNQLKLGFVLQLDRILPFRFVCSVSLHARFMLYRFESNEIDSPLSFKFHFHVSTPATALEEAYNLDFSLFGGFLDLYLYI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007847`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007847

Location Chr02:66239252-66245860 (+)

Description Similar to ADF1: Actin-depolymerizing factor 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59890`	Actin-depolymerizing protein.	Arabidopsis actin-depolymerizing factor AtADF4 mediates defense signal transduction triggered by the Pseudomonas syringae effector AvrPphB.2009 · DOI: 10.1104/pp.109.137604 Arabidopsis actin depolymerizing factor4 modulates the stochastic dynamic behavior of actin filaments in the cortical array of epidermal cells.2011 · DOI: 10.1105/tpc.111.090670 Arabidopsis Actin-Depolymerizing Factor-4 links pathogen perception, defense activation and transcription to cytoskeletal dynamics.2012 · DOI: 10.1371/journal.ppat.1003006 ACTIN DEPOLYMERIZING FACTOR4 regulates actin dynamics during innate immune signaling in Arabidopsis.2014 · DOI: 10.1105/tpc.113.122499
`At3g46010`	Actin-depolymerizing protein.	ADF proteins are involved in the control of flowering and regulate F-actin organization, cell expansion, and organ growth in Arabidopsis.2001 · DOI: 10.1105/tpc.13.6.1333 Arabidopsis actin-depolymerizing factors (ADFs) 1 and 9 display antagonist activities.2011 · DOI: 10.1016/j.febslet.2011.05.019
`At5g59880`	Actin-depolymerizing protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007847 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002758 innate immune response-activating signaling pathway Biological Process

GO:0007015 actin filament organization Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0015629 actin cytoskeleton Cellular Component

KEGG gene cross-reference

ath:AT3G46010

ath:AT5G59880

ath:AT5G59890

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444

Rank 1 · LXL04_007847 · OH-1004

Nucleus0.345

Rank 2 · LXL04_007847 · OH-1004

Mitochondrion0.172

Rank 3 · LXL04_007847 · OH-1004

Cell membrane0.090

Rank 4 · LXL04_007847 · OH-1004

Endoplasmic reticulum0.071

Rank 5 · LXL04_007847 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00241.26Cofilin_ADF348-473 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007847	`PF00241.26`	Cofilin_ADF	348	473	6.5e-39	133.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZSK3`	Arabidopsis thaliana	Actin-depolymerizing factor 4	80.303%	Swiss-Prot	weak database homology
`Q39250`	Arabidopsis thaliana	Actin-depolymerizing factor 1	76.429%	Swiss-Prot	weak database homology
`Q9ZSK4`	Arabidopsis thaliana	Actin-depolymerizing factor 3	77.273%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card