LXL04_007708 | RubberDandelionOmics

Gene overview

LXL04_007708

Reference: OH-1004 Chr: Chr02 Coordinates: 57353489-57354688 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

483 bp · LXL04_007708|LXL04_007708|OH1004|cDNA

ATGGCGGGTGATCCTTGTGAACTGGACGTGATCCGTAATGTGTATATGTTAGTATTGATACTTCTATGTTTAAATGGTGGTATTGCTATGGATGCTAAATTTGTAGGAAATGGGAAGATAGGAAAGGGGTATACTGTGCAGATTAAGTCAGATATTCCTAACGAAGATATAATGGTACATTGTAAGTCAAAAGATACAAATATCGGATATCATGTTCTTAATTCTTCCAATCTTGAGTTAAGTTGGTCCTTTCGTGAAAA...

CDS

Download CDS FASTA

483 bp · LXL04_007708|LXL04_007708|OH1004|CDS

ATGGCGGGTGATCCTTGTGAACTGGACGTGATCCGTAATGTGTATATGTTAGTATTGATACTTCTATGTTTAAATGGTGGTATTGCTATGGATGCTAAATTTGTAGGAAATGGGAAGATAGGAAAGGGGTATACTGTGCAGATTAAGTCAGATATTCCTAACGAAGATATAATGGTACATTGTAAGTCAAAAGATACAAATATCGGATATCATGTTCTTAATTCTTCCAATCTTGAGTTAAGTTGGTCCTTTCGTGAAAA...

Protein

Download Protein FASTA

160 aa · LXL04_007708|LXL04_007708|OH1004|PROTEIN

MAGDPCELDVIRNVYMLVLILLCLNGGIAMDAKFVGNGKIGKGYTVQIKSDIPNEDIMVHCKSKDTNIGYHVLNSSNLELSWSFRENIWGTTLYFCHFWRKMAEQKFDVFNITMFVWCDHGFDIGNNCNWEIKDDGFYFFDFHYQTWSKEYDWKPRAYIS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007708`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007708

Location Chr02:57353489-57354688 (+)

Description Similar to SPH5: S-protein homolog 5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04645`	S-protein homolog 5.	No verified direct reference in this release
`At3g26880`	S-protein homolog 21.	No verified direct reference in this release
`At5g36906`	S-protein homolog 24.	No verified direct reference in this release
`At5g05825`	S-protein homolog 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007708 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0060320 rejection of self pollen Biological Process

GO:0005576 extracellular region Cellular Component

KEGG gene cross-reference

ath:AT1G04645

ath:AT3G26880

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.373

Rank 1 · LXL04_007708 · OH-1004

Extracellular0.283

Rank 2 · LXL04_007708 · OH-1004

Cytoplasm0.182

Rank 3 · LXL04_007708 · OH-1004

Cell membrane0.165

Rank 4 · LXL04_007708 · OH-1004

Endoplasmic reticulum0.165

Rank 5 · LXL04_007708 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05938.18Self-incomp_S145-153 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007708	`PF05938.18`	Self-incomp_S1	45	153	2.6e-23	83.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O23020`	Arabidopsis thaliana	S-protein homolog 5	28.099%	Swiss-Prot	weak database homology
`Q9LW22`	Arabidopsis thaliana	S-protein homolog 21	31.579%	Swiss-Prot	moderate database homology
`P0DN92`	Arabidopsis thaliana	S-protein homolog 24	31.746%	Swiss-Prot	moderate database homology
`F2Q9V4`	Arabidopsis thaliana	S-protein homolog 6	38.750%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card