LXL04_007190 | RubberDandelionOmics

Gene overview

LXL04_007190

Reference: OH-1004 Chr: Chr02 Coordinates: 38545287-38546280 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

420 bp · LXL04_007190|LXL04_007190|OH1004|cDNA

ATGGATCAATCCAACGACAACAGGCAAGAGTTTGGTGAAGAAAGCATTTATCACCTGACCCACGGACCGAGTAGTTGCAATGCAAGAACAACCTGTTGGTTCAAATTCGGTAAAAATGGCGTCGATGCTAAAGGTGTTGGTATTTACGCCAGTCAGTCGCGGATTGGTTTCATCTCCCCATCCTTCAAGAGCCTTAGAATGATTGAAAACGAGGCCGATAAGTCCATTTTTAGCATCATCGGGACCAATTTCGCCAAGCT...

CDS

Download CDS FASTA

420 bp · LXL04_007190|LXL04_007190|OH1004|CDS

ATGGATCAATCCAACGACAACAGGCAAGAGTTTGGTGAAGAAAGCATTTATCACCTGACCCACGGACCGAGTAGTTGCAATGCAAGAACAACCTGTTGGTTCAAATTCGGTAAAAATGGCGTCGATGCTAAAGGTGTTGGTATTTACGCCAGTCAGTCGCGGATTGGTTTCATCTCCCCATCCTTCAAGAGCCTTAGAATGATTGAAAACGAGGCCGATAAGTCCATTTTTAGCATCATCGGGACCAATTTCGCCAAGCT...

Protein

Download Protein FASTA

139 aa · LXL04_007190|LXL04_007190|OH1004|PROTEIN

MDQSNDNRQEFGEESIYHLTHGPSSCNARTTCWFKFGKNGVDAKGVGIYASQSRIGFISPSFKSLRMIENEADKSIFSIIGTNFAKLQIRTNQNREMKEQRNREMKESPIGFKSEQIGTLFLDFFLIQLDFGQEEAKPV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007190`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007190

Location Chr02:38545287-38546280 (+)

Description Similar to LTD: Protein LHCP TRANSLOCATION DEFECT

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g50900`	Involved in the import of light-harvesting complex proteins (LHCP) and subsequent routing of these proteins to the chloroplast signal recognition particle (SRP) pathway.	The GDC1 gene encodes a novel ankyrin domain-containing protein that is essential for grana formation in Arabidopsis.2011 · DOI: 10.1104/pp.110.165589

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007190 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0090391 granum assembly Biological Process

GO:0009507 chloroplast Cellular Component

GO:0009535 chloroplast thylakoid membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0009941 chloroplast envelope Cellular Component

KEGG gene cross-reference

ath:AT1G50900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.444

Rank 1 · LXL04_007190 · OH-1004

Cytoplasm0.426

Rank 2 · LXL04_007190 · OH-1004

Mitochondrion0.138

Rank 3 · LXL04_007190 · OH-1004

Cell membrane0.072

Rank 4 · LXL04_007190 · OH-1004

Endoplasmic reticulum0.043

Rank 5 · LXL04_007190 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VY88`	Arabidopsis thaliana	Protein LHCP TRANSLOCATION DEFECT	72.222%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card