LXL04_005903 | RubberDandelionOmics

Gene overview

LXL04_005903

Reference: OH-1004 Chr: Chr01 Coordinates: 175465007-175481995 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

6954 bp · LXL04_005903|LXL04_005903|OH1004|cDNA

ATGGGCTGTGTTTGCTGCAAATTCCCATCATCTTTGTCTGATGGTGGTAAGAAAACCAAGCGGAAGAGACGAAAAACCGCAACAGCAGACGAGTTTTCACAAGTTATTCCGATCCCTTCTCACGATTTCAAGCTGGAGTGTGCTGCGCTTACACGACGTGGGTTTTACCCCGACACCCCCAATAAAGACAATCAAGATTCTTTCTGCATTAAAACAAGCATCCAAGGTAACCCCAATGTCCACATCTTCGGCGTTTTCGA...

CDS

Download CDS FASTA

6954 bp · LXL04_005903|LXL04_005903|OH1004|CDS

ATGGGCTGTGTTTGCTGCAAATTCCCATCATCTTTGTCTGATGGTGGTAAGAAAACCAAGCGGAAGAGACGAAAAACCGCAACAGCAGACGAGTTTTCACAAGTTATTCCGATCCCTTCTCACGATTTCAAGCTGGAGTGTGCTGCGCTTACACGACGTGGGTTTTACCCCGACACCCCCAATAAAGACAATCAAGATTCTTTCTGCATTAAAACAAGCATCCAAGGTAACCCCAATGTCCACATCTTCGGCGTTTTCGA...

Protein

Download Protein FASTA

2317 aa · LXL04_005903|LXL04_005903|OH1004|PROTEIN

MGCVCCKFPSSLSDGGKKTKRKRRKTATADEFSQVIPIPSHDFKLECAALTRRGFYPDTPNKDNQDSFCIKTSIQGNPNVHIFGVFDGHGHAGKQCSNFVKNRLIEILSNDETLIQDPVKAYTSAFSTTNTELHNNPDIDDSMSGTTAITVLVINDKLYVANVGDSRAVISVKGNQNRLISQDLSDDQTPYRNDECERVKHCGARVLSVDQVEGVKDPSVQSWGDEESSGSDPPRLWMQNAMYPGTAFTRSVGDSLAEKI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005903`
TK1151 ID	TkA01G008450
OH-1004 ID	LXL04_005903
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.700
Protein coverage (%)	TK1151 99.740 / OH-1004 16.530 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005903

Location Chr01:175465007-175481995 (-)

Description Similar to At3g06270: Probable protein phosphatase 2C 35

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06270`	Probable protein phosphatase 2C 35.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005903 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0019677 NAD+ catabolic process Biological Process

GO:0043068 positive regulation of programmed cell death Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0003953 NAD+ nucleosidase activity Molecular Function

GO:0004722 protein serine/threonine phosphatase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0043531 ADP binding Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G06270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.377

Rank 1 · LXL04_005903 · OH-1004

Cell membrane0.373

Rank 2 · LXL04_005903 · OH-1004

Nucleus0.269

Rank 3 · LXL04_005903 · OH-1004

Endoplasmic reticulum0.089

Rank 4 · LXL04_005903 · OH-1004

Plastid0.053

Rank 5 · LXL04_005903 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481.27PP2C75-316 aa

PF01582.26TIR413-559 aa

PF13676.12TIR_2416-529 aa

PF00931.29NB-ARC594-748 aa

PF23282.2WHD_ROQ1817-888 aa

PF01582.26TIR1349-1512 aa

PF13676.12TIR_21358-1459 aa

PF00931.29NB-ARC1525-1691 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005903	`PF00481.27`	PP2C	75	316	3.7e-38	132.4
LXL04_005903	`PF01582.26`	TIR	413	559	2.9e-91	304.8
LXL04_005903	`PF13676.12`	TIR_2	416	529	1.6e-35	122.9
LXL04_005903	`PF00931.29`	NB-ARC	594	748	5.6e-39	134.2
LXL04_005903	`PF23282.2`	WHD_ROQ1	817	888	2.3e-31	108.5
LXL04_005903	`PF01582.26`	TIR	1349	1512	2.9e-91	304.8
LXL04_005903	`PF13676.12`	TIR_2	1358	1459	1.6e-35	122.9
LXL04_005903	`PF00931.29`	NB-ARC	1525	1691	5.6e-39	134.2
LXL04_005903	`PF23282.2`	WHD_ROQ1	1761	1832	2.3e-31	108.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XJ53`	Arabidopsis thaliana	Probable protein phosphatase 2C 35	67.647%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card