LXL04_005825 | RubberDandelionOmics

Gene overview

LXL04_005825

Reference: OH-1004 Chr: Chr01 Coordinates: 174204688-174211536 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3207 bp · LXL04_005825|LXL04_005825|OH1004|cDNA

ATGTTTTTTTTGGTCTTTGAATCAATGAGAAGTTTATTGCCACAATGCTGCTACTTCACCGCGAGTTCGCTGTTGCTAATTGCATTCCTGTCGCCGGCGGCTGTCGATCAGGTGGCGGCAGCGGCGTCCGAGAAAGAGATCCTGCTTCAGTTCAAAGGTAACATAACAAGCGACCCTTACAATAGTTTGATTTCATGGGATTCTAGTACAGATCAGTGTAGAGATTATAGCGGTGTGTTTTGTGATTCTTTTGGGAATGT...

CDS

Download CDS FASTA

3207 bp · LXL04_005825|LXL04_005825|OH1004|CDS

ATGTTTTTTTTGGTCTTTGAATCAATGAGAAGTTTATTGCCACAATGCTGCTACTTCACCGCGAGTTCGCTGTTGCTAATTGCATTCCTGTCGCCGGCGGCTGTCGATCAGGTGGCGGCAGCGGCGTCCGAGAAAGAGATCCTGCTTCAGTTCAAAGGTAACATAACAAGCGACCCTTACAATAGTTTGATTTCATGGGATTCTAGTACAGATCAGTGTAGAGATTATAGCGGTGTGTTTTGTGATTCTTTTGGGAATGT...

Protein

Download Protein FASTA

1068 aa · LXL04_005825|LXL04_005825|OH1004|PROTEIN

MFFLVFESMRSLLPQCCYFTASSLLLIAFLSPAAVDQVAAAASEKEILLQFKGNITSDPYNSLISWDSSTDQCRDYSGVFCDSFGNVYKIVLWNTSLGGVLSPSLSELKSLRILTLFGNRFTGNIPPEFQELTTLWKINVSSNALSGSIPEFLGDLNSIRFLDLSRNGFEGSIPSSLFKVCEKTKFISLSHNNLSGALPIIVNNCLNLEGFDVSFNSLTGEFPSQICEIPPLSYLSVRNNMLTGTVHEQVSNCQRLELLD...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005825`
TK1151 ID	TkA01G014080
OH-1004 ID	LXL04_005825
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 84.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005825

Location Chr01:174204688-174211536 (+)

Description Similar to At1g12460: Probable LRR receptor-like serine/threonine-protein kinase At1g12460

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g12460`	Probable LRR receptor-like serine/threonine-protein kinase At1g12460.	No verified direct reference in this release
`At3g56370`	Probable LRR receptor-like serine/threonine-protein kinase IRK.	No verified direct reference in this release
`At3g28040`	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040.	No verified direct reference in this release
`At5g01890`	Leucine-rich repeat receptor-like protein kinase that may play a role in vascular tissues development.	No verified direct reference in this release
`At5g07180`	Receptor kinase that regulates inflorescence architecture and organ shape as well as stomatal patterning, including density and clustering, together with ERL1 and ER.	Synergistic interaction of three ERECTA-family receptor-like kinases controls Arabidopsis organ growth and flower development by promoting cell proliferation.2004 · DOI: 10.1242/dev.01028 Haploinsufficiency after successive loss of signaling reveals a role for ERECTA-family genes in Arabidopsis ovule development.2007 · DOI: 10.1242/dev.004788

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005825 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009553 embryo sac development Biological Process

GO:0010103 stomatal complex morphogenesis Biological Process

GO:0048364 root development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0051302 regulation of cell division Biological Process

GO:0090511 periclinal cell division Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0004672 protein kinase activity Molecular Function

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT1G12460

ath:AT3G28040

ath:AT3G56370

ath:AT5G01890

ath:AT5G07180

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.849

Rank 1 · LXL04_005825 · OH-1004

Endoplasmic reticulum0.089

Rank 2 · LXL04_005825 · OH-1004

Cytoplasm0.069

Rank 3 · LXL04_005825 · OH-1004

Nucleus0.062

Rank 4 · LXL04_005825 · OH-1004

Lysosome / Vacuole0.024

Rank 5 · LXL04_005825 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_242-82 aa

PF13855.13LRR_8110-168 aa

PF13855.13LRR_8231-289 aa

PF23598.2LRR_14320-503 aa

PF13855.13LRR_8403-449 aa

PF07714.24PK_Tyr_Ser-Thr612-891 aa

PF00069.32Pkinase613-832 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005825	`PF08263.18`	LRRNT_2	42	82	3.9e-07	31.0
LXL04_005825	`PF13855.13`	LRR_8	110	168	3.5e-23	81.8
LXL04_005825	`PF13855.13`	LRR_8	231	289	3.5e-23	81.8
LXL04_005825	`PF23598.2`	LRR_14	320	503	4.1e-17	62.7
LXL04_005825	`PF13855.13`	LRR_8	403	449	3.5e-23	81.8
LXL04_005825	`PF07714.24`	PK_Tyr_Ser-Thr	612	891	2.6e-34	119.4
LXL04_005825	`PF00069.32`	Pkinase	613	832	6.1e-32	111.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`C0LGE4`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase At1g12460	61.066%	Swiss-Prot	strong database homology
`Q9LY03`	Arabidopsis thaliana	Probable LRR receptor-like serine/threonine-protein kinase IRK	34.874%	Swiss-Prot	moderate database homology
`Q9LRT1`	Arabidopsis thaliana	Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040	36.625%	Swiss-Prot	moderate database homology
`Q9LZV7`	Arabidopsis thaliana	Leucine-rich repeat receptor-like protein kinase PXC2	32.727%	Swiss-Prot	moderate database homology
`Q6XAT2`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase ERL2	31.799%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card