LXL04_005695 | RubberDandelionOmics

Gene overview

LXL04_005695

Reference: OH-1004 Chr: Chr01 Coordinates: 170977183-170981463 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3477 bp · LXL04_005695|LXL04_005695|OH1004|cDNA

atgtcacaaCTTGGTCGACCTCCACCGGctccgccaccaccaccaccaccgttGTCGCCGGAAATTGAGGAAAATAACGGAGGAACGTTGGAGAGACAGATGACGGAATCTCAACGGAGCTTGTGGGAGAAAGAGGCTTCGTTTAACTGCCGTTTGGAATGGAGATATCTAGGTTACAGCGAAATTGGGTATAATACATGGGTTGCGATTAGTTTGTTGGGCCCTCAACAATGGAATCTGACGAAGCACTTTGCTATAAG...

CDS

Download CDS FASTA

3477 bp · LXL04_005695|LXL04_005695|OH1004|CDS

ATGTCACAACTTGGTCGACCTCCACCGGCTCCGCCACCACCACCACCACCGTTGTCGCCGGAAATTGAGGAAAATAACGGAGGAACGTTGGAGAGACAGATGACGGAATCTCAACGGAGCTTGTGGGAGAAAGAGGCTTCGTTTAACTGCCGTTTGGAATGGAGATATCTAGGTTACAGCGAAATTGGGTATAATACATGGGTTGCGATTAGTTTGTTGGGCCCTCAACAATGGAATCTGACGAAGCACTTTGCTATAAG...

Protein

Download Protein FASTA

1158 aa · LXL04_005695|LXL04_005695|OH1004|PROTEIN

MSQLGRPPPAPPPPPPPLSPEIEENNGGTLERQMTESQRSLWEKEASFNCRLEWRYLGYSEIGYNTWVAISLLGPQQWNLTKHFAIRVIEKVNPHIIKCFKIAATAKPPGSSSTLLFMCNSESISEIRKKDSYKLCSTDDLFWVAILSVHVDALIPFDKMNQQRNPTSTTKSICQCRFFQCGFKTYSNRGYENKTRALMARMKTGNNWQPKFDSYHIVLGGYMDCKKKSALHTMLNQINVKMQDLFDKLWGRNSNKKIAL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005695`
TK1151 ID	TkA05G465360
OH-1004 ID	LXL04_005695
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	44.400
Protein coverage (%)	TK1151 33.582 / OH-1004 11.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005695

Location Chr01:170977183-170981463 (+)

Description Similar to A4: Elongation factor 1-alpha 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g60390`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release
`At1g07920`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release
`At1g07930`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release
`At1g07940`	This protein promotes the GTP-dependent binding of aminoacyl-tRNA to the A-site of ribosomes during protein biosynthesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005695 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006412 translation Biological Process

GO:0006414 translational elongation Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

KEGG gene cross-reference

ath:AT1G07920

ath:AT1G07930

ath:AT1G07940

ath:AT5G60390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.514

Rank 1 · LXL04_005695 · OH-1004

Nucleus0.213

Rank 2 · LXL04_005695 · OH-1004

Cell membrane0.136

Rank 3 · LXL04_005695 · OH-1004

Mitochondrion0.108

Rank 4 · LXL04_005695 · OH-1004

Lysosome / Vacuole0.082

Rank 5 · LXL04_005695 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8GTY0`	Arabidopsis thaliana	Elongation factor 1-alpha 4	68.182%	Swiss-Prot	weak database homology
`Q0WL56`	Arabidopsis thaliana	Elongation factor 1-alpha 3	68.182%	Swiss-Prot	weak database homology
`Q8W4H7`	Arabidopsis thaliana	Elongation factor 1-alpha 2	68.182%	Swiss-Prot	weak database homology
`P0DH99`	Arabidopsis thaliana	Elongation factor 1-alpha 1	68.182%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card