LXL04_005538 | RubberDandelionOmics

Gene overview

LXL04_005538

Reference: OH-1004 Chr: Chr01 Coordinates: 167893210-167893975 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

441 bp · LXL04_005538|LXL04_005538|OH1004|cDNA

ATGAACGTGATTGATAACTATCTCATTTCTTCCTCTGGTGGTTCTGGTGAATCAAACGTCTTCTATTACAATATGAAAGGAGACTATTACAGATATCTGGCAGAATTCAAATTCGGAAATGACAGGAAAGATGTTGCTGACCTGTCAATGAAAGCATATGAAGCAGCTACAACTACAGCAGAAGCTGAATTGCCACCTACACACCCCATTCGATTAGGACTGGCTTTGAATTTCTTAGTCTTCTACTATGAAATCATGAA...

CDS

Download CDS FASTA

441 bp · LXL04_005538|LXL04_005538|OH1004|CDS

ATGAACGTGATTGATAACTATCTCATTTCTTCCTCTGGTGGTTCTGGTGAATCAAACGTCTTCTATTACAATATGAAAGGAGACTATTACAGATATCTGGCAGAATTCAAATTCGGAAATGACAGGAAAGATGTTGCTGACCTGTCAATGAAAGCATATGAAGCAGCTACAACTACAGCAGAAGCTGAATTGCCACCTACACACCCCATTCGATTAGGACTGGCTTTGAATTTCTTAGTCTTCTACTATGAAATCATGAA...

Protein

Download Protein FASTA

146 aa · LXL04_005538|LXL04_005538|OH1004|PROTEIN

MNVIDNYLISSSGGSGESNVFYYNMKGDYYRYLAEFKFGNDRKDVADLSMKAYEAATTTAEAELPPTHPIRLGLALNFLVFYYEIMNSAERACHLAKQAFDEAISEVDTLNEESYKDSTLIMQLLRYNLTLWNSDLSEEGDICGRT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005538`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005538

Location Chr01:167893210-167893975 (-)

Description Similar to 14-3-3-like protein B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g42590`	Is associated with a DNA binding complex that binds to the G box, a well-characterized cis-acting DNA regulatory element found in plant genes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005538 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007165 signal transduction Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:0048528 post-embryonic root development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0005509 calcium ion binding Molecular Function

GO:0045309 protein phosphorylated amino acid binding Molecular Function

KEGG gene cross-reference

ath:AT2G42590

gmx:547990

nta:107784347

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.673

Rank 1 · LXL04_005538 · OH-1004

Nucleus0.344

Rank 2 · LXL04_005538 · OH-1004

Cell membrane0.065

Rank 3 · LXL04_005538 · OH-1004

Endoplasmic reticulum0.061

Rank 4 · LXL04_005538 · OH-1004

Plastid0.053

Rank 5 · LXL04_005538 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00244.2714-3-32-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_005538	`PF00244.27`	14-3-3	2	133	5.7e-60	203.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96299`	Arabidopsis thaliana	14-3-3-like protein GF14 mu	79.286%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card