LXL04_005215 | RubberDandelionOmics

Gene overview

LXL04_005215

Reference: OH-1004 Chr: Chr01 Coordinates: 157881079-157883813 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

450 bp · LXL04_005215|LXL04_005215|OH1004|cDNA

ATGGAGACGGCGAGAAAGAAGGAGACGCTTGATGATTTCGTTCAAAAGACGATCGTATTCAGTTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGCGATGATTATGAAGCAAAGATATCGGATTTTGGTATGGCTAAGCTAATGCCTGAGGGTCAAGAAACTAATGTGACACAAGGGTATTTCGATCCTGTTGCTGTTTTTTTTGGGTGGTCGTTGTGGCAATTCTGTATTCCCTTTGCGACTGTTCTTTT...

CDS

Download CDS FASTA

450 bp · LXL04_005215|LXL04_005215|OH1004|CDS

ATGGAGACGGCGAGAAAGAAGGAGACGCTTGATGATTTCGTTCAAAAGACGATCGTATTCAGTTTATTCTTCAAGTTCTTCAAATCCACCAACATCCTTTTGAGCGATGATTATGAAGCAAAGATATCGGATTTTGGTATGGCTAAGCTAATGCCTGAGGGTCAAGAAACTAATGTGACACAAGGGTATTTCGATCCTGTTGCTGTTTTTTTTGGGTGGTCGTTGTGGCAATTCTGTATTCCCTTTGCGACTGTTCTTTT...

Protein

Download Protein FASTA

149 aa · LXL04_005215|LXL04_005215|OH1004|PROTEIN

METARKKETLDDFVQKTIVFSLFFKFFKSTNILLSDDYEAKISDFGMAKLMPEGQETNVTQGYFDPVAVFFGWSLWQFCIPFATVLLSCSGLLFISAGSVPWVFMHQVVVVAVFPPRMLSAKVLRMLVRLPCSGVRFIPCYCSVLGLLF

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_005215`
TK1151 ID	TkA01G075440
OH-1004 ID	LXL04_005215
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	92.200
Protein coverage (%)	TK1151 84.507 / OH-1004 85.906 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_005215

Location Chr01:157881079-157883813 (-)

Description Similar to PBL28: Probable serine/threonine-protein kinase PBL28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g24030`	May be involved in plant defense signaling.	No verified direct reference in this release
`At2g26290`	May play a role in the signal transduction pathway of osmotic stress (Probable).	An Arabidopsis thaliana root-specific kinase homolog is induced by dehydration, ABA, and NaCl.1995 · DOI: 10.1046/j.1365-313x.1995.08010037.x
`At2g05940`	Serine/threonine-protein kinase involved in disease resistance.	xopAC-triggered immunity against Xanthomonas depends on Arabidopsis receptor-like cytoplasmic kinase genes PBL2 and RIPK.2013 · DOI: 10.1371/journal.pone.0073469 Pseudomonas syringae Effector AvrPphB Suppresses AvrB-Induced Activation of RPM1 but Not AvrRpm1-Induced Activation.2015 · DOI: 10.1094/mpmi-08-14-0248-r
`At5g01020`	May be involved in plant defense signaling.	No verified direct reference in this release
`At5g35580`	Involved in defense responses.	PBL13 Is a Serine/Threonine Protein Kinase That Negatively Regulates Arabidopsis Immune Responses.2015 · DOI: 10.1104/pp.15.01391

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005215 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0006468 protein phosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0032491 detection of molecule of fungal origin Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0050777 negative regulation of immune response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0062207 regulation of pattern recognition receptor signaling pathway Biological Process

GO:1903428 positive regulation of reactive oxygen species biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT1G24030

ath:AT2G05940

ath:AT2G26290

ath:AT5G01020

ath:AT5G35580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.372

Rank 1 · LXL04_005215 · OH-1004

Nucleus0.313

Rank 2 · LXL04_005215 · OH-1004

Endoplasmic reticulum0.176

Rank 3 · LXL04_005215 · OH-1004

Mitochondrion0.156

Rank 4 · LXL04_005215 · OH-1004

Cell membrane0.127

Rank 5 · LXL04_005215 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q84M95`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL28	50.000%	Swiss-Prot	weak database homology
`O64842`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL12	41.892%	Swiss-Prot	weak database homology
`Q9ZUF4`	Arabidopsis thaliana	Serine/threonine-protein kinase RIPK	47.368%	Swiss-Prot	weak database homology
`Q8GXZ3`	Arabidopsis thaliana	Probable serine/threonine-protein kinase PBL8	47.368%	Swiss-Prot	weak database homology
`F4JZW1`	Arabidopsis thaliana	Serine/threonine-protein kinase PBL13	45.614%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card