LXL04_004916 | RubberDandelionOmics

Gene overview

LXL04_004916

Reference: OH-1004 Chr: Chr01 Coordinates: 150115860-150116510 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

480 bp · LXL04_004916|LXL04_004916|OH1004|cDNA

ATGCATGACCTAGAACTACACTTACAAGATGTGGATACCAAAATTCGTCGAACAGAAGCTACATTGAATGAACAACGCAGGCTTCAAAATCTGGTGGCCAAAAAGACAGCTGAAAGAAGCACTCTGGTTCAGGAGCAAGAGCAGCGATATAGTGATCTGGCAGAAGAGAATGAGGATCCTATTGAAGGTTTAATGGAATGGAATGGGAAGTTCAGGGAAAGAATAGCAGATCTTGAAGATAAAATTGAAACGTTAGAGAG...

CDS

Download CDS FASTA

480 bp · LXL04_004916|LXL04_004916|OH1004|CDS

ATGCATGACCTAGAACTACACTTACAAGATGTGGATACCAAAATTCGTCGAACAGAAGCTACATTGAATGAACAACGCAGGCTTCAAAATCTGGTGGCCAAAAAGACAGCTGAAAGAAGCACTCTGGTTCAGGAGCAAGAGCAGCGATATAGTGATCTGGCAGAAGAGAATGAGGATCCTATTGAAGGTTTAATGGAATGGAATGGGAAGTTCAGGGAAAGAATAGCAGATCTTGAAGATAAAATTGAAACGTTAGAGAG...

Protein

Download Protein FASTA

159 aa · LXL04_004916|LXL04_004916|OH1004|PROTEIN

MHDLELHLQDVDTKIRRTEATLNEQRRLQNLVAKKTAERSTLVQEQEQRYSDLAEENEDPIEGLMEWNGKFRERIADLEDKIETLERDKTNIEAKSSRCQPQINEYIKNVGKLQAEYDNYTSLKKERDSTVQELYRQHNLGSLPKTPFSNEVASNHIAA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004916`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004916

Location Chr01:150115860-150116510 (+)

Description Similar to RAD50: DNA repair protein RAD50

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31970`	Component of the MRN complex, which plays a central role in double-strand break (DSB) repair, DNA recombination, maintenance of telomere integrity and meiosis.	Disruption of the Arabidopsis RAD50 gene leads to plant sterility and MMS sensitivity.2001 · DOI: 10.1046/j.1365-313x.2001.00928.x RAD50 function is essential for telomere maintenance in Arabidopsis.2001 · DOI: 10.1073/pnas.98.4.1711 Homologous recombination in planta is stimulated in the absence of Rad50.2001 · DOI: 10.1093/embo-reports/kve069 Meiotic defects in the Arabidopsis rad50 mutant point to conservation of the MRX complex function in early stages of meiotic recombination.2004 · DOI: 10.1007/s00412-004-0309-1

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004916 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000722 telomere maintenance via recombination Biological Process

GO:0000723 telomere maintenance Biological Process

GO:0006302 double-strand break repair Biological Process

GO:0006312 mitotic recombination Biological Process

GO:0007004 telomere maintenance via telomerase Biological Process

GO:0016233 telomere capping Biological Process

GO:0070192 chromosome organization involved in meiotic cell cycle Biological Process

GO:0000794 condensed nuclear chromosome Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0030870 Mre11 complex Cellular Component

GO:0003691 double-stranded telomeric DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G31970

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.468

Rank 1 · LXL04_004916 · OH-1004

Cytoplasm0.467

Rank 2 · LXL04_004916 · OH-1004

Mitochondrion0.043

Rank 3 · LXL04_004916 · OH-1004

Cell membrane0.037

Rank 4 · LXL04_004916 · OH-1004

Extracellular0.030

Rank 5 · LXL04_004916 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SL02`	Arabidopsis thaliana	DNA repair protein RAD50	45.161%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card