LXL04_004542 | RubberDandelionOmics

Gene overview

LXL04_004542

Reference: OH-1004 Chr: Chr01 Coordinates: 139743220-139747441 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

558 bp · LXL04_004542|LXL04_004542|OH1004|cDNA

atgacgaaaactcagatgttctggaaacctaactcaagGGACAACATTTATCTGTCTCACAAGCCAAGTCCAATTCGGAATTTAAGAAGGTACACAACAACCTTAGTTTCAACATCTGTTTACATATTTGGGAAATCTTCATCTGCTGCTGGATTGACCGCCACAGTTGCAAAAGAACCAGAAACCGGAGAGTTTTGTATCGAGCTATACTACCTTAGGTTTACAAAGATTGACCAAGGATCAGAAGAAATTAAAACACA...

CDS

Download CDS FASTA

558 bp · LXL04_004542|LXL04_004542|OH1004|CDS

ATGACGAAAACTCAGATGTTCTGGAAACCTAACTCAAGGGACAACATTTATCTGTCTCACAAGCCAAGTCCAATTCGGAATTTAAGAAGGTACACAACAACCTTAGTTTCAACATCTGTTTACATATTTGGGAAATCTTCATCTGCTGCTGGATTGACCGCCACAGTTGCAAAAGAACCAGAAACCGGAGAGTTTTGTATCGAGCTATACTACCTTAGGTTTACAAAGATTGACCAAGGATCAGAAGAAATTAAAACACA...

Protein

Download Protein FASTA

185 aa · LXL04_004542|LXL04_004542|OH1004|PROTEIN

MTKTQMFWKPNSRDNIYLSHKPSPIRNLRRYTTTLVSTSVYIFGKSSSAAGLTATVAKEPETGEFCIELYYLRFTKIDQGSEEIKTHPLLYWTTERLKDRELQEIAKGRFGNAKEDLDVLLETGLNKCPGSKAITQLIRTRNVLFNEGAPNIPTDITPGIQHTPNNHQQPEPNEGAPNIPTDITP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004542`
TK1151 ID	TkA03G423940
OH-1004 ID	LXL04_004542
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	47.800
Protein coverage (%)	TK1151 57.265 / OH-1004 33.514 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004542

Location Chr01:139743220-139747441 (+)

Description Similar to MCM6: DNA replication licensing factor MCM6

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g44635`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0235800`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release
`UniProt: B8AZX3`	Probable component of the MCM2-7 complex (MCM complex) that may function as a DNA helicase and which is essential to undergo a single round of replication initiation and elongation per cell cycle in eukaryotic cells.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004542 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000727 double-strand break repair via break-induced replication Biological Process

GO:0006270 DNA replication initiation Biological Process

GO:1902969 mitotic DNA replication Biological Process

GO:0000347 THO complex Cellular Component

GO:0000785 chromatin Cellular Component

GO:0005634 nucleus Cellular Component

GO:0042555 MCM complex Cellular Component

GO:0003678 DNA helicase activity Molecular Function

GO:0003697 single-stranded DNA binding Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT5G44635

dosa:Os05g0235800

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.323

Rank 1 · LXL04_004542 · OH-1004

Nucleus0.291

Rank 2 · LXL04_004542 · OH-1004

Mitochondrion0.200

Rank 3 · LXL04_004542 · OH-1004

Extracellular0.129

Rank 4 · LXL04_004542 · OH-1004

Cell membrane0.092

Rank 5 · LXL04_004542 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00493.30MCM30-68 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004542	`PF00493.30`	MCM	30	68	3.4e-06	27.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KAB8`	Arabidopsis thaliana	DNA replication licensing factor MCM6	61.818%	Swiss-Prot	weak database homology
`Q6F353`	Oryza sativa subsp. japonica	DNA replication licensing factor MCM6	79.487%	Swiss-Prot	weak database homology
`B8AZX3`	Oryza sativa subsp. indica	DNA replication licensing factor MCM6	79.487%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card