LXL04_004341 | RubberDandelionOmics

Gene overview

LXL04_004341

Reference: OH-1004 Chr: Chr01 Coordinates: 133125639-133128089 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2451 bp · LXL04_004341|LXL04_004341|OH1004|cDNA

ATGCATCCTTGTGTTTTTATAACTTTCTCCTTTCTCTTGCTACTCCTTGCAACTGTCACTGCTGACCAATTGGTGGCAGTGGAAGCTGTTAACAAGAACTGCTCCGATGTGGAGAGACGTGCTCTCCTTGATTTCAAAGCTGGCCTTCAAGATCCCGATGGCGCTCTCTCTACATGGACAGCCGAAGATCATGATTGTTGTTCATGGCTAGGAGTCTTTTGTGACATCCAAGGAGGTCACAGTCATGTTACATGGCTTCT...

CDS

Download CDS FASTA

2451 bp · LXL04_004341|LXL04_004341|OH1004|CDS

ATGCATCCTTGTGTTTTTATAACTTTCTCCTTTCTCTTGCTACTCCTTGCAACTGTCACTGCTGACCAATTGGTGGCAGTGGAAGCTGTTAACAAGAACTGCTCCGATGTGGAGAGACGTGCTCTCCTTGATTTCAAAGCTGGCCTTCAAGATCCCGATGGCGCTCTCTCTACATGGACAGCCGAAGATCATGATTGTTGTTCATGGCTAGGAGTCTTTTGTGACATCCAAGGAGGTCACAGTCATGTTACATGGCTTCT...

Protein

Download Protein FASTA

816 aa · LXL04_004341|LXL04_004341|OH1004|PROTEIN

MHPCVFITFSFLLLLLATVTADQLVAVEAVNKNCSDVERRALLDFKAGLQDPDGALSTWTAEDHDCCSWLGVFCDIQGGHSHVTWLLMFDNNLHGTIPKSIGSLTKLEDLDLSNNSFYGNIPPEFGNLTNLQHLSLDDVGLCRVENPEWLSHLSHLETLYIDGVSLAKADNWVDVISSLPKLTWLSLDGCELSHVKYPNSLFLNSSSSIIHLSLKNNNLNSSMYRWLNKLTSNNLLHLDISGNRLDGIPTYFGNFCYLQF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004341`
TK1151 ID	TkA01G161740
OH-1004 ID	LXL04_004341
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	60.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004341

Location Chr01:133125639-133128089 (+)

Description Similar to EIX2: Receptor-like protein EIX2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g46330`	Constitutes the pattern-recognition receptor (PPR) that determines the specific perception of flagellin (flg22), a potent elicitor of the defense response to pathogen-associated molecular patterns (PAMPs).	No verified direct reference in this release
`At4g13810`	Receptor-like protein 47.	No verified direct reference in this release
`At5g40170`	Receptor-like protein 54.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004341 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002220 innate immune response activating cell surface receptor signaling pathway Biological Process

GO:0007165 signal transduction Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT4G13810

ath:AT5G40170

sly:543900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861

Rank 1 · LXL04_004341 · OH-1004

Endoplasmic reticulum0.094

Rank 2 · LXL04_004341 · OH-1004

Cytoplasm0.057

Rank 3 · LXL04_004341 · OH-1004

Nucleus0.039

Rank 4 · LXL04_004341 · OH-1004

Lysosome / Vacuole0.030

Rank 5 · LXL04_004341 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08263.18LRRNT_238-75 aa

PF13855.13LRR_882-137 aa

PF23598.2LRR_1495-317 aa

PF13855.13LRR_8306-345 aa

PF12799.14LRR_4310-349 aa

PF23598.2LRR_14440-569 aa

PF13855.13LRR_8612-655 aa

PF23598.2LRR_14619-699 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004341	`PF08263.18`	LRRNT_2	38	75	1.6e-14	54.6
LXL04_004341	`PF13855.13`	LRR_8	82	137	2.5e-31	107.9
LXL04_004341	`PF23598.2`	LRR_14	95	317	8.6e-29	101.1
LXL04_004341	`PF13855.13`	LRR_8	306	345	2.5e-31	107.9
LXL04_004341	`PF12799.14`	LRR_4	310	349	8.8e-23	80.5
LXL04_004341	`PF23598.2`	LRR_14	440	569	8.6e-29	101.1
LXL04_004341	`PF13855.13`	LRR_8	612	655	2.5e-31	107.9
LXL04_004341	`PF23598.2`	LRR_14	619	699	8.6e-29	101.1
LXL04_004341	`PF13855.13`	LRR_8	665	703	2.5e-31	107.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FL28`	Arabidopsis thaliana	LRR receptor-like serine/threonine-protein kinase FLS2	32.040%	Swiss-Prot	moderate database homology
`Q9SVN2`	Arabidopsis thaliana	Receptor-like protein 47	30.796%	Swiss-Prot	moderate database homology
`F4KHA2`	Arabidopsis thaliana	Receptor-like protein 54	30.882%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card