LXL04_004238 | RubberDandelionOmics

Gene overview

LXL04_004238

Reference: OH-1004 Chr: Chr01 Coordinates: 130702710-130705296 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

939 bp · LXL04_004238|LXL04_004238|OH1004|cDNA

ATGCGACCCCATATCCGACCACACCAGTATGCAGAACTGAAACCAGTCCCATGTTTGACTTACTCTGATGCTCAAATGCTGAGAGAAAAATGTGCTACTCCTATTCTTAAGCAGGTCAGAGATGATGTTATAAGATTCCGTTATGGTGATGAACAACATTTGGAAGAGGCTTTGAAACGTATTTTCCAGTATGGTCTGGGTGGAGGTGTGGCAAGAAGAAATGCTCCAATTCGAAAAAAGATTCGTGAAGAAGGGTATTA...

CDS

Download CDS FASTA

939 bp · LXL04_004238|LXL04_004238|OH1004|CDS

ATGCGACCCCATATCCGACCACACCAGTATGCAGAACTGAAACCAGTCCCATGTTTGACTTACTCTGATGCTCAAATGCTGAGAGAAAAATGTGCTACTCCTATTCTTAAGCAGGTCAGAGATGATGTTATAAGATTCCGTTATGGTGATGAACAACATTTGGAAGAGGCTTTGAAACGTATTTTCCAGTATGGTCTGGGTGGAGGTGTGGCAAGAAGAAATGCTCCAATTCGAAAAAAGATTCGTGAAGAAGGGTATTA...

Protein

Download Protein FASTA

312 aa · LXL04_004238|LXL04_004238|OH1004|PROTEIN

MRPHIRPHQYAELKPVPCLTYSDAQMLREKCATPILKQVRDDVIRFRYGDEQHLEEALKRIFQYGLGGGVARRNAPIRKKIREEGYYGYFWDQQRINCGSSLVKCRCGSKRLLWQWFVHNLGLFLKWFSKEIIQGIEGRFWIRCLGIYSTGFIFWDYFCINFCLSLNKSFCIFGPKDFLKGIEGFECTEFIFWDYFVWLSLLEDMSFLQTPKLIDAACSQKLHMKHLRRNFIRHSVTTNVLASQSWQKQISPFVTMLVMY...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_004238`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_004238

Location Chr01:130702710-130705296 (-)

Description Similar to XI-B: Myosin-8

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g04160`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At2g31900`	Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation.	No verified direct reference in this release
`At5g43900`	Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.	Peroxisomal localization of a myosin XI isoform in Arabidopsis thaliana.2005 · DOI: 10.1093/pcp/pci085 Two class XI myosins function in organelle trafficking and root hair development in Arabidopsis.2008 · DOI: 10.1104/pp.107.113654 A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.2009 · DOI: 10.1104/pp.109.136853 Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.2012 · DOI: 10.1093/jxb/err265

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_004238 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0010090 trichome morphogenesis Biological Process

GO:0030048 actin filament-based movement Biological Process

GO:0048467 gynoecium development Biological Process

GO:0048767 root hair elongation Biological Process

GO:0051645 Golgi localization Biological Process

GO:0051646 mitochondrion localization Biological Process

GO:0060151 peroxisome localization Biological Process

GO:0090436 leaf pavement cell development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005777 peroxisome Cellular Component

KEGG gene cross-reference

ath:AT1G04160

ath:AT2G31900

ath:AT5G43900

syn:slr0575

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.425

Rank 1 · LXL04_004238 · OH-1004

Nucleus0.386

Rank 2 · LXL04_004238 · OH-1004

Mitochondrion0.185

Rank 3 · LXL04_004238 · OH-1004

Endoplasmic reticulum0.084

Rank 4 · LXL04_004238 · OH-1004

Cell membrane0.081

Rank 5 · LXL04_004238 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11016.14DUF28549-85 aa

PF00063.28Myosin_head199-301 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_004238	`PF11016.14`	DUF2854	9	85	6.6e-18	65.7
LXL04_004238	`PF00063.28`	Myosin_head	199	301	4.4e-06	26.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4I460`	Arabidopsis thaliana	Myosin-8	79.412%	Swiss-Prot	weak database homology
`F4IRU3`	Arabidopsis thaliana	Myosin-12	79.412%	Swiss-Prot	weak database homology
`Q9LKB9`	Arabidopsis thaliana	Myosin-6	73.529%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card