LXL04_003607 | RubberDandelionOmics

Gene overview

LXL04_003607

Reference: OH-1004 Chr: Chr01 Coordinates: 88598728-88601638 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · LXL04_003607|LXL04_003607|OH1004|cDNA

ATGATTGATTCTCTATCTACTTCGTTGTTTTATAGGGACAGTTGCGAGATACTTGTAGAGTATGGCGTGGAGCCACATGAATATGGGTCTGTGGTGAATGGTCTGAGAAAGAACCCGGAGGCATGGCTTGATTTCATGATGAATTGCGAGATACTGGTAGAGTATGGCGTGGAGCCACATGAATATGGGTCTGTGGTGAATGGTCTGAGAAAGAACCCGGAGGCATGGCTTGATTTCATGATGAGCGAttcaaaacaaaa...

CDS

Download CDS FASTA

720 bp · LXL04_003607|LXL04_003607|OH1004|CDS

ATGATTGATTCTCTATCTACTTCGTTGTTTTATAGGGACAGTTGCGAGATACTTGTAGAGTATGGCGTGGAGCCACATGAATATGGGTCTGTGGTGAATGGTCTGAGAAAGAACCCGGAGGCATGGCTTGATTTCATGATGAATTGCGAGATACTGGTAGAGTATGGCGTGGAGCCACATGAATATGGGTCTGTGGTGAATGGTCTGAGAAAGAACCCGGAGGCATGGCTTGATTTCATGATGAGCGATTCAAAACAAAA...

Protein

Download Protein FASTA

239 aa · LXL04_003607|LXL04_003607|OH1004|PROTEIN

MIDSLSTSLFYRDSCEILVEYGVEPHEYGSVVNGLRKNPEAWLDFMMNCEILVEYGVEPHEYGSVVNGLRKNPEAWLDFMMSDSKQNKTAFVTFKDPKALQIALLLSEVFETDNAMSMTLENFSPNSKGNGTSPRSGRVYMSKAQDVVTSVLAKYSAIRQYALNKAKTFDEKHKLRTNATARVNSLDNRVGLSEKINVGVLVVNEEVKYVTAGTAWLNTAFGKVAKAGQVAGSKVGFPS

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003607`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003607

Location Chr01:88598728-88601638 (+)

Description Similar to BPA1: Binding partner of ACD11 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g16840`	Binding partner of ACD11 1.	No verified direct reference in this release
`At2g01770`	Vacuolar iron transporter involved in the transfer of iron ions from the cytosol to the vacuole for intracellular iron storage.	Localization of iron in Arabidopsis seed requires the vacuolar membrane transporter VIT1.2006 · DOI: 10.1126/science.1132563 Identification of the endodermal vacuole as the iron storage compartment in the Arabidopsis embryo.2009 · DOI: 10.1104/pp.109.144444 Bypassing Iron Storage in Endodermal Vacuoles Rescues the Iron Mobilization Defect in the natural resistance associated-macrophage protein3natural resistance associated-macrophage protein4 Double Mutant.2015 · DOI: 10.1104/pp.15.00380

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0463400`	Vacuolar iron transporter involved in the transfer of iron ions from the cytosol to the vacuole for intracellular iron storage.	Vacuolar membrane transporters OsVIT1 and OsVIT2 modulate iron translocation between flag leaves and seeds in rice.2012 · DOI: 10.1111/j.1365-313x.2012.05088.x

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003607 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006826 iron ion transport Biological Process

GO:0006879 intracellular iron ion homeostasis Biological Process

GO:0030026 intracellular manganese ion homeostasis Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005634 nucleus Cellular Component

GO:0005774 vacuolar membrane Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0010494 cytoplasmic stress granule Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0005381 iron ion transmembrane transporter activity Molecular Function

KEGG gene cross-reference

ath:AT5G16840

dosa:Os04g0463400

egr:104453645

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.362

Rank 1 · LXL04_003607 · OH-1004

Mitochondrion0.239

Rank 2 · LXL04_003607 · OH-1004

Nucleus0.144

Rank 3 · LXL04_003607 · OH-1004

Peroxisome0.114

Rank 4 · LXL04_003607 · OH-1004

Cell membrane0.091

Rank 5 · LXL04_003607 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LFD5`	Arabidopsis thaliana	Binding partner of ACD11 1	33.516%	Swiss-Prot	moderate database homology
`Q9ZUA5`	Arabidopsis thaliana	Vacuolar iron transporter 1	64.286%	Swiss-Prot	weak database homology
`Q6MWE5`	Oryza sativa subsp. japonica	Vacuolar iron transporter 1	66.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card