LXL04_003257 | RubberDandelionOmics

Gene overview

LXL04_003257

Reference: OH-1004 Chr: Chr01 Coordinates: 72275270-72278241 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1758 bp · LXL04_003257|LXL04_003257|OH1004|cDNA

ATGAAGAAATCGGAGCGGCCAAAGGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTATGATTCTTTCATGTAATTTACGCACCGAAGAAGTAGTTCGAAGCAGCATTTTGTCCAGACGATGGAGGTACCTGTGGACTGCAATTCCCTCTGTGGAGATAGACGTACGCTACAAAGAAAACGTCACACAAAACACAGTCAAACAAAGCGAATTCAAAGAGTTTGTGTATTGGGT...

CDS

Download CDS FASTA

1758 bp · LXL04_003257|LXL04_003257|OH1004|CDS

ATGAAGAAATCGGAGCGGCCAAAGGCATCAAAACACGAAGATGGGGTTGATTTGATCAGTAGCATGCCAGATGGTGTTCTTCTTATGATTCTTTCATGTAATTTACGCACCGAAGAAGTAGTTCGAAGCAGCATTTTGTCCAGACGATGGAGGTACCTGTGGACTGCAATTCCCTCTGTGGAGATAGACGTACGCTACAAAGAAAACGTCACACAAAACACAGTCAAACAAAGCGAATTCAAAGAGTTTGTGTATTGGGT...

Protein

Download Protein FASTA

585 aa · LXL04_003257|LXL04_003257|OH1004|PROTEIN

MKKSERPKASKHEDGVDLISSMPDGVLLMILSCNLRTEEVVRSSILSRRWRYLWTAIPSVEIDVRYKENVTQNTVKQSEFKEFVYWVLSNRSADLDCFRLFCFDFYSMSTVGRWIHIAVTRNVKRLVLGFGPKERAADVELPHCLVNCGSLEVLNLCLWGRRLRLPNVMGFPALRVLHLSEFNLPEDGDWIKGFFESLPLLEELSLTNCFMEELDLLCISCLKLKTLSLGNIDDLLMCDGIKISCPKLVDLDITDSLKKA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_003257`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_003257

Location Chr01:72275270-72278241 (-)

Description Similar to At3g52680: F-box/FBD/LRR-repeat protein At3g52680

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g52680`	F-box/FBD/LRR-repeat protein At3g52680.	No verified direct reference in this release
`At5g56420`	F-box/FBD/LRR-repeat protein At5g56420.	No verified direct reference in this release
`At1g69630`	F-box/LRR-repeat protein 13.	No verified direct reference in this release
`At4g00160`	F-box/FBD/LRR-repeat protein At4g00160.	No verified direct reference in this release
`At5g56560`	Putative FBD-associated F-box protein At5g56560.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_003257 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

KEGG gene cross-reference

ath:AT1G69630

ath:AT3G52680

ath:AT4G00160

ath:AT5G56420

ath:AT5G56560

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.781

Rank 1 · LXL04_003257 · OH-1004

Cytoplasm0.220

Rank 2 · LXL04_003257 · OH-1004

Cell membrane0.061

Rank 3 · LXL04_003257 · OH-1004

Endoplasmic reticulum0.046

Rank 4 · LXL04_003257 · OH-1004

Plastid0.021

Rank 5 · LXL04_003257 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23622.2LRR_At1g61320_AtMIF194-319 aa

PF24758.2LRR_At5g56370112-337 aa

PF13966.12zf-RVT514-577 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_003257	`PF23622.2`	LRR_At1g61320_AtMIF1	94	319	1.9e-07	31.5
LXL04_003257	`PF24758.2`	LRR_At5g56370	112	337	1.2e-12	48.7
LXL04_003257	`PF13966.12`	zf-RVT	514	577	4.6e-12	47.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LXJ6`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At3g52680	33.333%	Swiss-Prot	weak database homology
`Q9FM89`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At5g56420	30.769%	Swiss-Prot	weak database homology
`Q9FWZ1`	Arabidopsis thaliana	F-box/LRR-repeat protein 13	31.229%	Swiss-Prot	weak database homology
`Q8LF09`	Arabidopsis thaliana	F-box/FBD/LRR-repeat protein At4g00160	31.967%	Swiss-Prot	weak database homology
`Q9FJV2`	Arabidopsis thaliana	Putative FBD-associated F-box protein At5g56560	24.942%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card