LXL04_002823 | RubberDandelionOmics

Gene overview

LXL04_002823

Reference: OH-1004 Chr: Chr01 Coordinates: 58947382-58948987 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

834 bp · LXL04_002823|LXL04_002823|OH1004|cDNA

ATGTTGAGAAGAAAACTCTCATCTCTATTATCAAACTCCATCAGAAATGCATCAATTTACACCAAACCAGCCTCACATTTCTCAATCACAAAGGTGTTACACAACCCAGTTCATCATTCGAACTTACTTCAGAAACCCGTCAATTCATTTGGGGTTCAGAGCATTCGAGCTTACAGTTTGTTGAGCTTGAATGATCTGAGGGACAACAAAGGCGCTACGAAACAGAAAACAAGAAAGGGTCGTGGAATCGGATCGGGTAA...

CDS

Download CDS FASTA

834 bp · LXL04_002823|LXL04_002823|OH1004|CDS

ATGTTGAGAAGAAAACTCTCATCTCTATTATCAAACTCCATCAGAAATGCATCAATTTACACCAAACCAGCCTCACATTTCTCAATCACAAAGGTGTTACACAACCCAGTTCATCATTCGAACTTACTTCAGAAACCCGTCAATTCATTTGGGGTTCAGAGCATTCGAGCTTACAGTTTGTTGAGCTTGAATGATCTGAGGGACAACAAAGGCGCTACGAAACAGAAAACAAGAAAGGGTCGTGGAATCGGATCGGGTAA...

Protein

Download Protein FASTA

277 aa · LXL04_002823|LXL04_002823|OH1004|PROTEIN

MLRRKLSSLLSNSIRNASIYTKPASHFSITKVLHNPVHHSNLLQKPVNSFGVQSIRAYSLLSLNDLRDNKGATKQKTRKGRGIGSGKGKTAGRGHKGQKARGTHKFGFEGGQTPLRRRMPKRGFKNPFSLEFQPVGLGKIARLINAGKIDSSELITMKTLKDTGAIGKQIRDGVRLMGRGAEHIQWPIHLEVSRVTVRAKEAVEAAGGSVRKVYYNKLGFRALLKPEWFEKKGRLIPKAARPPPKQMDKVDSIGRLPAPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_002823`
TK1151 ID	TkA01G418510
OH-1004 ID	LXL04_002823
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_002823`
Location	Chr01:58947382-58948987 (+)
Description	Similar to rplO: 50S ribosomal protein L15 (Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_002823` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0006412 translation Biological Process GO:0022625 cytosolic large ribosomal subunit Cellular Component GO:0003735 structural constituent of ribosome Molecular Function GO:0019843 rRNA binding Molecular Function
KEGG gene cross-reference	mch:Mchl_2460 met:M446_0334 mex:Mext_2182 mno:Mnod_1927 mrd:Mrad2831_2199 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Mitochondrion0.918

Rank 1 · LXL04_002823 · OH-1004

Nucleus0.032

Rank 2 · LXL04_002823 · OH-1004

Cytoplasm0.030

Rank 3 · LXL04_002823 · OH-1004

Plastid0.008

Rank 4 · LXL04_002823 · OH-1004

Cell membrane0.006

Rank 5 · LXL04_002823 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29471.1Ribosomal_uL15_N83-117 aa

PF00828.26Ribosomal_L27A134-210 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_002823	`PF29471.1`	Ribosomal_uL15_N	83	117	2.6e-16	60.0
LXL04_002823	`PF00828.26`	Ribosomal_L27A	134	210	2.9e-17	63.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card