LXL04_001560 | RubberDandelionOmics

Gene overview

LXL04_001560

Reference: OH-1004 Chr: Chr01 Coordinates: 29183067-29184455 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1389 bp · LXL04_001560|LXL04_001560|OH1004|cDNA

ATGTCTTCCATTTCCGATGAAAATCGACAAACGAGTGTACTGCTTGTTACAGCGCACCCTCAAGGTCACATAAACCCCATGCTAAGACTCGGCAAACTTCTTGCTTCCAAAGGCCTCCATGTCACTCTCGCTACCAATGACCCTGCTCTAAAAAACCGCTCCTCCGTCAACGGCGGCGTCCACCTTGAGTATTTTTCCGACGGTCTACCTGACGATCACGAAAGACTGAACGGCGATATAGATAAATTCATGGTCTCGCT...

CDS

Download CDS FASTA

1389 bp · LXL04_001560|LXL04_001560|OH1004|CDS

ATGTCTTCCATTTCCGATGAAAATCGACAAACGAGTGTACTGCTTGTTACAGCGCACCCTCAAGGTCACATAAACCCCATGCTAAGACTCGGCAAACTTCTTGCTTCCAAAGGCCTCCATGTCACTCTCGCTACCAATGACCCTGCTCTAAAAAACCGCTCCTCCGTCAACGGCGGCGTCCACCTTGAGTATTTTTCCGACGGTCTACCTGACGATCACGAAAGACTGAACGGCGATATAGATAAATTCATGGTCTCGCT...

Protein

Download Protein FASTA

462 aa · LXL04_001560|LXL04_001560|OH1004|PROTEIN

MSSISDENRQTSVLLVTAHPQGHINPMLRLGKLLASKGLHVTLATNDPALKNRSSVNGGVHLEYFSDGLPDDHERLNGDIDKFMVSLGEFGPGNLSELIRSSGRKFACLINNTFVPWVADVAAELELPCAMLWIQACTAYHVYNCFYNRLNEFPTENNLDMSVNLPGLPSLRSEDLPSFVLPSNTMFTLDGLLKDVFYNLHKYKWMLGNSFMELEKDVITAVNDAGLPFWPVGPLVPANLFGKVDSIDGDLKGLNKFKSA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001560`
TK1151 ID	TkA08G031190
OH-1004 ID	LXL04_001560
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	31.900
Protein coverage (%)	TK1151 95.260 / OH-1004 95.887 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001560

Location Chr01:29183067-29184455 (-)

Description Similar to UGT84B1: UDP-glycosyltransferase 84B1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23260`	Possesses low quercetin 7-O-glucosyltransferase activity in vitro.	No verified direct reference in this release
`At2g23250`	UDP-glycosyltransferase 84B2.	No verified direct reference in this release
`At4g15490`	UDP-glucosyltransferase that forms glucose esters with phenylpropanoids.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001560 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0090354 regulation of auxin metabolic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0035251 UDP-glucosyltransferase activity Molecular Function

GO:0047215 indole-3-acetate beta-glucosyltransferase activity Molecular Function

GO:0047218 hydroxycinnamate 4-beta-glucosyltransferase activity Molecular Function

GO:0047913 gallate 1-beta-glucosyltransferase activity Molecular Function

GO:0050284 sinapate 1-glucosyltransferase activity Molecular Function

GO:0050412 cinnamate beta-D-glucosyltransferase activity Molecular Function

GO:0050645 limonoid glucosyltransferase activity Molecular Function

GO:0080043 quercetin 3-O-glucosyltransferase activity Molecular Function

GO:0080044 quercetin 7-O-glucosyltransferase activity Molecular Function

KEGG gene cross-reference

ag:AHA54051

ath:AT2G23250

ath:AT2G23260

ath:AT4G15490

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.680

Rank 1 · LXL04_001560 · OH-1004

Nucleus0.192

Rank 2 · LXL04_001560 · OH-1004

Endoplasmic reticulum0.093

Rank 3 · LXL04_001560 · OH-1004

Plastid0.085

Rank 4 · LXL04_001560 · OH-1004

Peroxisome0.079

Rank 5 · LXL04_001560 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00201.25UDPGT274-420 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001560	`PF00201.25`	UDPGT	274	420	7.4e-24	85.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22182`	Arabidopsis thaliana	UDP-glycosyltransferase 84B1	43.197%	Swiss-Prot	moderate database homology
`O22183`	Arabidopsis thaliana	UDP-glycosyltransferase 84B2	42.630%	Swiss-Prot	moderate database homology
`O23401`	Arabidopsis thaliana	UDP-glycosyltransferase 84A3	40.678%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card