LXL04_001367 | RubberDandelionOmics

Gene overview

LXL04_001367

Reference: OH-1004 Chr: Chr01 Coordinates: 25005335-25007730 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1077 bp · LXL04_001367|LXL04_001367|OH1004|cDNA

ATGTCTCAGGTAAACGAGAAAGATGCCGCGGCCAAGCCTGCCACAGCCACGGttttgtttttttatatatatatgtttttctTTTCCCATGCAGAAGAAAAGAAACCAGCCTCTGAATCAAGCTCCTCAGATACACAACCTGGAAGCATACCTCCCATGCCTTCCATGCCTGGAGCTGGATTCCCTGCAAATCCATTTGACTTTTCATCCATGGCTGGTCTACTCAACGACCCTAGCATTAAGGAATTAGCGGAACAAAT...

CDS

Download CDS FASTA

1077 bp · LXL04_001367|LXL04_001367|OH1004|CDS

ATGTCTCAGGTAAACGAGAAAGATGCCGCGGCCAAGCCTGCCACAGCCACGGTTTTGTTTTTTTATATATATATGTTTTTCTTTTCCCATGCAGAAGAAAAGAAACCAGCCTCTGAATCAAGCTCCTCAGATACACAACCTGGAAGCATACCTCCCATGCCTTCCATGCCTGGAGCTGGATTCCCTGCAAATCCATTTGACTTTTCATCCATGGCTGGTCTACTCAACGACCCTAGCATTAAGGAATTAGCGGAACAAAT...

Protein

Download Protein FASTA

358 aa · LXL04_001367|LXL04_001367|OH1004|PROTEIN

MSQVNEKDAAAKPATATVLFFYIYMFFFSHAEEKKPASESSSSDTQPGSIPPMPSMPGAGFPANPFDFSSMAGLLNDPSIKELAEQIAKDPSFNQMAEQLQQTFHAPDEGVPQFDTQQYYSTMQQVMQNPQFMTMAERLGNAMMQDPSMSQMLESLSNPAQKDQLEERMARIKEDPSLKPILEEIESGGPTAMMRYWNDQDVLKKLGEAMGLAVSEDATAASAGNEPEEDTNEDESIVHQTASVGDVEGLKKALESGADK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001367`
TK1151 ID	TkA01G542520
OH-1004 ID	LXL04_001367
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	93.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001367

Location Chr01:25005335-25007730 (-)

Description Similar to AKR2B: Ankyrin repeat domain-containing protein 2B

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g17390`	Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.	No verified direct reference in this release
`At4g35450`	Exhibits chaperone activity toward chloroplast outer envelope membrane, mitochondrion outer membrane, endoplasmic reticulum membrane and peroxisomal proteins, by recruiting specific proteins containing a single transmembrane associated with an AKR2A-binding sequence (ABS) and subsequently binding glycolipids (e.g. monogalactosyldiacylglycerol (MGDG) and phosphatidylglycerol (PG)) present in the membrane of the target organelle.	An ankyrin repeat-containing protein plays a role in both disease resistance and antioxidation metabolism.2002 · DOI: 10.1046/j.0960-7412.2001.01205.x AKR2A-mediated import of chloroplast outer membrane proteins is essential for chloroplast biogenesis.2008 · DOI: 10.1038/ncb1683 ANKYRIN REPEAT-CONTAINING PROTEIN 2A is an essential molecular chaperone for peroxisomal membrane-bound ASCORBATE PEROXIDASE3 in Arabidopsis.2010 · DOI: 10.1105/tpc.109.065979

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001367 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000209 protein polyubiquitination Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006457 protein folding Biological Process

GO:0007052 mitotic spindle organization Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0015031 protein transport Biological Process

GO:0016055 Wnt signaling pathway Biological Process

GO:0018105 peptidyl-serine phosphorylation Biological Process

GO:0018107 peptidyl-threonine phosphorylation Biological Process

GO:0032210 regulation of telomere maintenance via telomerase Biological Process

GO:0032212 positive regulation of telomere maintenance via telomerase Biological Process

KEGG gene cross-reference

ath:AT2G17390

ath:AT4G35450

hsa:8658

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.444

Rank 1 · LXL04_001367 · OH-1004

Peroxisome0.277

Rank 2 · LXL04_001367 · OH-1004

Mitochondrion0.244

Rank 3 · LXL04_001367 · OH-1004

Nucleus0.179

Rank 4 · LXL04_001367 · OH-1004

Endoplasmic reticulum0.104

Rank 5 · LXL04_001367 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF17830.7STI1-HOP_DP167-211 aa

PF12796.14Ank_2226-295 aa

PF24521.3Ank_KRIT1232-346 aa

PF12796.14Ank_2239-329 aa

PF13637.13Ank_4245-287 aa

PF00023.37Ank267-298 aa

PF13637.13Ank_4274-320 aa

PF13857.13Ank_5286-340 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001367	`PF17830.7`	STI1-HOP_DP	167	211	3.6e-14	53.1
LXL04_001367	`PF12796.14`	Ank_2	226	295	1.6e-39	135.1
LXL04_001367	`PF24521.3`	Ank_KRIT1	232	346	3.5e-07	30.8
LXL04_001367	`PF12796.14`	Ank_2	239	329	1.6e-39	135.1
LXL04_001367	`PF13637.13`	Ank_4	245	287	6.5e-21	74.6
LXL04_001367	`PF00023.37`	Ank	267	298	2.2e-19	69.2
LXL04_001367	`PF13637.13`	Ank_4	274	320	6.5e-21	74.6
LXL04_001367	`PF13857.13`	Ank_5	286	340	1.2e-13	51.8
LXL04_001367	`PF12796.14`	Ank_2	291	352	1.6e-39	135.1
LXL04_001367	`PF00023.37`	Ank	299	330	2.2e-19	69.2
LXL04_001367	`PF13606.13`	Ank_3	300	326	4.8e-13	48.6
LXL04_001367	`PF13637.13`	Ank_4	304	352	6.5e-21	74.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q29Q26`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein 2B	69.069%	Swiss-Prot	strong database homology
`Q9SAR5`	Arabidopsis thaliana	Ankyrin repeat domain-containing protein 2A	70.358%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card