LXL04_001050 | RubberDandelionOmics

Gene overview

LXL04_001050

Reference: OH-1004 Chr: Chr01 Coordinates: 19250481-19251128 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

474 bp · LXL04_001050|LXL04_001050|OH1004|cDNA

ATGCAGGCACTTAAGGCTCTCATATTGGAAAGAATGGGTAAATTGGATGAAGCACTATCTGTCTGCATCAATGCTGAAGAGCTTTTATACAAGAATGATTTAATATTGATTGATGATCTCACATTAAGCACATTGCAGATTGTTTTTCAACGGCTAGATCATTTGGACATGGCTACCAGTTGTTATGAGTATGCATGTGGAAAATTTTCAAACAATTTGGAACTGATGATGGGACTCTTCAATTGCTATGTCCGTGAATA...

CDS

Download CDS FASTA

474 bp · LXL04_001050|LXL04_001050|OH1004|CDS

ATGCAGGCACTTAAGGCTCTCATATTGGAAAGAATGGGTAAATTGGATGAAGCACTATCTGTCTGCATCAATGCTGAAGAGCTTTTATACAAGAATGATTTAATATTGATTGATGATCTCACATTAAGCACATTGCAGATTGTTTTTCAACGGCTAGATCATTTGGACATGGCTACCAGTTGTTATGAGTATGCATGTGGAAAATTTTCAAACAATTTGGAACTGATGATGGGACTCTTCAATTGCTATGTCCGTGAATA...

Protein

Download Protein FASTA

157 aa · LXL04_001050|LXL04_001050|OH1004|PROTEIN

MQALKALILERMGKLDEALSVCINAEELLYKNDLILIDDLTLSTLQIVFQRLDHLDMATSCYEYACGKFSNNLELMMGLFNCYVREYSFVKQQQIAIKMYKIAGEERFLLWAVCSINMYKSGSRSKRKRRRKRHPPPTPPTIQKRIVRIRTENEINV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_001050`
TK1151 ID	TkA04G033860
OH-1004 ID	LXL04_001050
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	96.600
Protein coverage (%)	TK1151 10.882 / OH-1004 73.885 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_001050

Location Chr01:19250481-19251128 (-)

Description Similar to NAA25: N-terminal acetyltransferase B complex auxiliary subunit NAA25

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g58450`	Auxiliary subunit of the NatB N-alpha-acetyltransferase complex.	Mutation of an Arabidopsis NatB N-alpha-terminal acetylation complex component causes pleiotropic developmental defects.2013 · DOI: 10.1371/journal.pone.0080697

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001050 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002253 activation of immune response Biological Process

GO:0006911 phagocytosis, engulfment Biological Process

GO:0006955 immune response Biological Process

GO:0007010 cytoskeleton organization Biological Process

GO:0010592 positive regulation of lamellipodium assembly Biological Process

GO:0030042 actin filament depolymerization Biological Process

GO:0045087 innate immune response Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005764 lysosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT5G58450

dme:Dmel_CG4845

hsa:80018

mmu:231713

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.467

Rank 1 · LXL04_001050 · OH-1004

Cytoplasm0.410

Rank 2 · LXL04_001050 · OH-1004

Mitochondrion0.067

Rank 3 · LXL04_001050 · OH-1004

Cell membrane0.058

Rank 4 · LXL04_001050 · OH-1004

Endoplasmic reticulum0.051

Rank 5 · LXL04_001050 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF31234.1TPR_Psidin_N2-128 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_001050	`PF31234.1`	TPR_Psidin_N	2	128	2.7e-39	135.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KEY9`	Arabidopsis thaliana	N-terminal acetyltransferase B complex auxiliary subunit NAA25	84.483%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card