LXL04_000810 | RubberDandelionOmics

Gene overview

LXL04_000810

Reference: OH-1004 Chr: Chr01 Coordinates: 15039661-15041106 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1362 bp · LXL04_000810|LXL04_000810|OH1004|cDNA

ATGGGAGCCTTGGATGATGCTCACTACAATGCGGTGCTAGAAAATGGAGTGAAGCTTGGTCGTTGTGAGTTTGAGCAAGAACCAGAGACTGTAGCCATTGAAGATGCTGTGAAGGTTTTGTTACGGGGTTTGGGTGAAGACATCAATAGAGAAGGTATTAGAAAGACCCCTCTTCGTGTCGCTAAAGCCCTTCGTGAAGGAACTAGAGGGTATAAACAGAACGTGAAAGACATAGTCCAGGGTGCGTTATTCCCGGAATC...

CDS

Download CDS FASTA

1362 bp · LXL04_000810|LXL04_000810|OH1004|CDS

ATGGGAGCCTTGGATGATGCTCACTACAATGCGGTGCTAGAAAATGGAGTGAAGCTTGGTCGTTGTGAGTTTGAGCAAGAACCAGAGACTGTAGCCATTGAAGATGCTGTGAAGGTTTTGTTACGGGGTTTGGGTGAAGACATCAATAGAGAAGGTATTAGAAAGACCCCTCTTCGTGTCGCTAAAGCCCTTCGTGAAGGAACTAGAGGGTATAAACAGAACGTGAAAGACATAGTCCAGGGTGCGTTATTCCCGGAATC...

Protein

Download Protein FASTA

453 aa · LXL04_000810|LXL04_000810|OH1004|PROTEIN

MGALDDAHYNAVLENGVKLGRCEFEQEPETVAIEDAVKVLLRGLGEDINREGIRKTPLRVAKALREGTRGYKQNVKDIVQGALFPESGLETGVGHAGGAGGLVLVRDLDLFSYCESCLLPFQVKCHVGYIPSGQRVVGLSKLSRVADIFTKRLQDPQRLADDICSGLQNGINPTGVAVVLHCSHIHFPDSHSTFLPTHKRWVNVIVNSGSGSFRKPESTNWVDFFGLLRRPNITLHNIRSKTNNKDSWCPSRANTGPGVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000810`
TK1151 ID	TkA01G585770
OH-1004 ID	LXL04_000810
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	97.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000810

Location Chr01:15039661-15041106 (-)

Description Similar to GCH1: GTP cyclohydrolase 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g07270`	GTP cyclohydrolase 1 is the first enzyme in the biosynthetic pathway leading to folic acid.	Folate synthesis in plants: the first step of the pterin branch is mediated by a unique bimodular GTP cyclohydrolase I.2002 · DOI: 10.1073/pnas.192278499

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000810 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006729 tetrahydrobiopterin biosynthetic process Biological Process

GO:0006730 one-carbon metabolic process Biological Process

GO:0006979 response to oxidative stress Biological Process

GO:0008277 regulation of G protein-coupled receptor signaling pathway Biological Process

GO:0046654 tetrahydrofolate biosynthetic process Biological Process

GO:0046656 folic acid biosynthetic process Biological Process

GO:0140460 response to Gram-negative bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0016020 membrane Cellular Component

GO:0045335 phagocytic vesicle Cellular Component

GO:0003934 GTP cyclohydrolase I activity Molecular Function

KEGG gene cross-reference

ath:AT3G07270

cch:Cag_0372

ddi:DDB_G0288481

sly:543831

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.331

Rank 1 · LXL04_000810 · OH-1004

Cytoplasm0.304

Rank 2 · LXL04_000810 · OH-1004

Mitochondrion0.245

Rank 3 · LXL04_000810 · OH-1004

Plastid0.116

Rank 4 · LXL04_000810 · OH-1004

Cell membrane0.053

Rank 5 · LXL04_000810 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01227.28GTP_cyclohydroI33-185 aa

PF01227.28GTP_cyclohydroI263-449 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000810	`PF01227.28`	GTP_cyclohydroI	33	185	8.8e-73	244.3
LXL04_000810	`PF01227.28`	GTP_cyclohydroI	263	449	8.8e-73	244.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SFV7`	Arabidopsis thaliana	GTP cyclohydrolase 1	60.435%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card