LXL04_000781 | RubberDandelionOmics

Gene overview

LXL04_000781

Reference: OH-1004 Chr: Chr01 Coordinates: 14325935-14329956 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1869 bp · LXL04_000781|LXL04_000781|OH1004|cDNA

ATGAGTGGGGCGAGACTGTGTTCATTATTGGGTGAATTGGGGTACGAAGGTCATGGGGCACTTGATCCAGACAGCTTTGAATGGCCATTTCAGTACGAAGATGCTCGTCCTATACTCGATTGGCTATGCTCCAGCCTTCGTCCCTCCAATGTCCTCTCCGCCTCTGAACTTTCCCAGTATGAACAGTTTATACAAGATGGAAAGCTTTTGGAGGGGGAAGACCTAGATTTTGCTTATGAAAGCATATCAGCCTTTTCAAC...

CDS

Download CDS FASTA

1869 bp · LXL04_000781|LXL04_000781|OH1004|CDS

ATGAGTGGGGCGAGACTGTGTTCATTATTGGGTGAATTGGGGTACGAAGGTCATGGGGCACTTGATCCAGACAGCTTTGAATGGCCATTTCAGTACGAAGATGCTCGTCCTATACTCGATTGGCTATGCTCCAGCCTTCGTCCCTCCAATGTCCTCTCCGCCTCTGAACTTTCCCAGTATGAACAGTTTATACAAGATGGAAAGCTTTTGGAGGGGGAAGACCTAGATTTTGCTTATGAAAGCATATCAGCCTTTTCAAC...

Protein

Download Protein FASTA

622 aa · LXL04_000781|LXL04_000781|OH1004|PROTEIN

MSGARLCSLLGELGYEGHGALDPDSFEWPFQYEDARPILDWLCSSLRPSNVLSASELSQYEQFIQDGKLLEGEDLDFAYESISAFSTRRDNQEAVFGAEEGLKEIRNIGFERDATLAYKTEAMELQRQLGHLQSQYDMLSTQASALIQGKRARVASTSTVNGQLTTIDDSLSARNLEMNAVLGRIASTAQELAHFHSGDEDGIYLAYSDFHPYLLVDSLCMKELNQWFVKQLDTGPYRLVAEEGKSKCSWVNLDDISNTL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000781`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000781

Location Chr01:14325935-14329956 (-)

Description Similar to AUG3: AUGMIN subunit 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g48520`	Involved in microtubules reorganization during spindle and phragmoplast development.	Augmin plays a critical role in organizing the spindle and phragmoplast microtubule arrays in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086892

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000781 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007098 centrosome cycle Biological Process

GO:0010968 regulation of microtubule nucleation Biological Process

GO:0031023 microtubule organizing center organization Biological Process

GO:0051225 spindle assembly Biological Process

GO:0051301 cell division Biological Process

GO:0080175 phragmoplast microtubule organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005813 centrosome Cellular Component

GO:0005815 microtubule organizing center Cellular Component

GO:0005819 spindle Cellular Component

KEGG gene cross-reference

ath:AT5G48520

dre:566923

hsa:79441

mmu:231123

xla:446808

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.604

Rank 1 · LXL04_000781 · OH-1004

Nucleus0.317

Rank 2 · LXL04_000781 · OH-1004

Golgi apparatus0.107

Rank 3 · LXL04_000781 · OH-1004

Lysosome / Vacuole0.064

Rank 4 · LXL04_000781 · OH-1004

Cell membrane0.060

Rank 5 · LXL04_000781 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF14932.12HAUS-augmin328-295 aa

PF27045.1HAUS3_C549-618 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000781	`PF14932.12`	HAUS-augmin3	28	295	4.5e-81	272.9
LXL04_000781	`PF27045.1`	HAUS3_C	549	618	9.2e-07	29.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q0WQE7`	Arabidopsis thaliana	AUGMIN subunit 3	79.904%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card