LXL04_000303 | RubberDandelionOmics

Gene overview

LXL04_000303

Reference: OH-1004 Chr: Chr01 Coordinates: 5651479-5657944 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1659 bp · LXL04_000303|LXL04_000303|OH1004|cDNA

ATGGCCATGGTTAGCTCCAAGGTATTCCTGGCTGCATCGACGGTTGTTCTACTGATATCTGTGCTGTTGTCCCTCCGATTAACCACCAATAATCACTCCAGTAATGAAGACGTCGAAGTTATTCCGGTTGACGGTGGCGCAATTGGACCTGAGAGCTTCGATTTCAATCCTGTGGATGGAACTGGTCCGTACACCGGCGTTTCTGATGGTCGGATTATTAAATGGATTGCTAGCGAACAGCGGTGGACTGATTTTGCGGT...

CDS

Download CDS FASTA

1659 bp · LXL04_000303|LXL04_000303|OH1004|CDS

ATGGCCATGGTTAGCTCCAAGGTATTCCTGGCTGCATCGACGGTTGTTCTACTGATATCTGTGCTGTTGTCCCTCCGATTAACCACCAATAATCACTCCAGTAATGAAGACGTCGAAGTTATTCCGGTTGACGGTGGCGCAATTGGACCTGAGAGCTTCGATTTCAATCCTGTGGATGGAACTGGTCCGTACACCGGCGTTTCTGATGGTCGGATTATTAAATGGATTGCTAGCGAACAGCGGTGGACTGATTTTGCGGT...

Protein

Download Protein FASTA

552 aa · LXL04_000303|LXL04_000303|OH1004|PROTEIN

MAMVSSKVFLAASTVVLLISVLLSLRLTTNNHSSNEDVEVIPVDGGAIGPESFDFNPVDGTGPYTGVSDGRIIKWIASEQRWTDFAVTSPNREGCGGPEMEHICGRTLGLKFDEKSGHLFIADAYIGLLSVGQTGGLATSLVSKVQGNPLMFTNSLDFDQTNRFVYFTDSSQRYTRRDHMLVVLTNDKTGSLLKYDIESKEVTVILHNLTFPNGVSLSQDGNFLLVAETTNCRILRFWLKTSKAGTLEVFADLPGYPDNI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000303`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000303

Location Chr01:5651479-5657944 (-)

Description Similar to SSL10: Protein STRICTOSIDINE SYNTHASE-LIKE 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g57030`	Protein STRICTOSIDINE SYNTHASE-LIKE 10.	No verified direct reference in this release
`At2g41290`	Protein STRICTOSIDINE SYNTHASE-LIKE 2.	No verified direct reference in this release
`At1g08470`	Protein STRICTOSIDINE SYNTHASE-LIKE 3.	No verified direct reference in this release
`At3g57010`	Protein STRICTOSIDINE SYNTHASE-LIKE 8.	No verified direct reference in this release
`At3g57020`	Protein STRICTOSIDINE SYNTHASE-LIKE 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000303 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000325 plant-type vacuole Cellular Component

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009505 plant-type cell wall Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016787 hydrolase activity Molecular Function

KEGG gene cross-reference

ath:AT1G08470

ath:AT2G41290

ath:AT3G57030

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.357

Rank 1 · LXL04_000303 · OH-1004

Lysosome / Vacuole0.319

Rank 2 · LXL04_000303 · OH-1004

Cytoplasm0.155

Rank 3 · LXL04_000303 · OH-1004

Cell membrane0.125

Rank 4 · LXL04_000303 · OH-1004

Extracellular0.117

Rank 5 · LXL04_000303 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03088.23Str_synth154-241 aa

PF08450.19SGL186-275 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000303	`PF03088.23`	Str_synth	154	241	8.7e-29	100.2
LXL04_000303	`PF08450.19`	SGL	186	275	1.2e-14	55.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q4V3D9`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 10	51.887%	Swiss-Prot	moderate database homology
`Q9SLG8`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 2	47.090%	Swiss-Prot	moderate database homology
`Q8VWF6`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 3	46.749%	Swiss-Prot	moderate database homology
`Q9M1J7`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 8	41.573%	Swiss-Prot	moderate database homology
`Q9M1J6`	Arabidopsis thaliana	Protein STRICTOSIDINE SYNTHASE-LIKE 9	43.548%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card