LXL04_000232 | RubberDandelionOmics

Gene overview

LXL04_000232

Reference: OH-1004 Chr: Chr01 Coordinates: 4393303-4396989 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1290 bp · LXL04_000232|LXL04_000232|OH1004|cDNA

ATGGACTCTAGGCAACAGCGTACGGTACAAGTCAAGCTTCCGATTACAACCATTTCACCACCGCCATCCACGACGGGCAACGTAGCTTCCTTTCGCAGTCGGAGCCGTAAATCGGCCATGGCTGCCTCTGCCGGTGCTAAAACTCTACCCTCTTCCTCATCTCATTCTGCTGGTGCTCCTGATTCCTTCGATATGTCCACTGGATTTCCACCGAAGCCCTCACTCAAACCCGATCAACTCCGTGACTGCGTCCAAGCTCT...

CDS

Download CDS FASTA

1290 bp · LXL04_000232|LXL04_000232|OH1004|CDS

ATGGACTCTAGGCAACAGCGTACGGTACAAGTCAAGCTTCCGATTACAACCATTTCACCACCGCCATCCACGACGGGCAACGTAGCTTCCTTTCGCAGTCGGAGCCGTAAATCGGCCATGGCTGCCTCTGCCGGTGCTAAAACTCTACCCTCTTCCTCATCTCATTCTGCTGGTGCTCCTGATTCCTTCGATATGTCCACTGGATTTCCACCGAAGCCCTCACTCAAACCCGATCAACTCCGTGACTGCGTCCAAGCTCT...

Protein

Download Protein FASTA

429 aa · LXL04_000232|LXL04_000232|OH1004|PROTEIN

MDSRQQRTVQVKLPITTISPPPSTTGNVASFRSRSRKSAMAASAGAKTLPSSSSHSAGAPDSFDMSTGFPPKPSLKPDQLRDCVQALKFFKEKWTDQYSLIEKEFSILQIFFQQSSTFLGTFHMSSIVESNEYVICSISINDYGPYCYQDHRMRASEANSSCSVARLNVNCRKNRYTDVVPFDSNRIVLDPCKDHRSSAMGYINASLITAEANQSESVSRFIATQGPLPETFEDFWEMVLQNHCPAIVMLTRLIDHHRIQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000232`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000232

Location Chr01:4393303-4396989 (-)

Description Similar to PTP1: Protein-tyrosine-phosphatase PTP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g71860`	Protein-tyrosine-phosphatase that dephosphorylates and probably inhibits MPK6 in non-oxidative stress conditions.	ATMPK4, an Arabidopsis homolog of mitogen-activated protein kinase, is activated in vitro by AtMEK1 through threonine phosphorylation.2000 · DOI: 10.1104/pp.122.4.1301 MAP kinase phosphatase1 and protein tyrosine phosphatase1 are repressors of salicylic acid synthesis and SNC1-mediated responses in Arabidopsis.2009 · DOI: 10.1105/tpc.109.067678 Molecular characterization of a tyrosine-specific protein phosphatase encoded by a stress-responsive gene in Arabidopsis.1998 · DOI: 10.1105/tpc.10.5.849

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000232 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0001933 negative regulation of protein phosphorylation Biological Process

GO:0003084 positive regulation of systemic arterial blood pressure Biological Process

GO:0006470 protein dephosphorylation Biological Process

GO:0006952 defense response Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0009966 regulation of signal transduction Biological Process

GO:0009968 negative regulation of signal transduction Biological Process

GO:0010460 positive regulation of heart rate Biological Process

GO:0010812 negative regulation of cell-substrate adhesion Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0030036 actin cytoskeleton organization Biological Process

GO:0030100 regulation of endocytosis Biological Process

KEGG gene cross-reference

ath:AT1G71860

gga:395688

hsa:5770

rno:24697

rno:306281

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.582

Rank 1 · LXL04_000232 · OH-1004

Cell membrane0.286

Rank 2 · LXL04_000232 · OH-1004

Nucleus0.251

Rank 3 · LXL04_000232 · OH-1004

Mitochondrion0.059

Rank 4 · LXL04_000232 · OH-1004

Golgi apparatus0.057

Rank 5 · LXL04_000232 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00102.33Y_phosphatase170-411 aa

PF22785.2Tc-R-P320-365 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000232	`PF00102.33`	Y_phosphatase	170	411	2.9e-71	240.5
LXL04_000232	`PF22785.2`	Tc-R-P	320	365	2.2e-07	32.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O82656`	Arabidopsis thaliana	Protein-tyrosine-phosphatase PTP1	66.788%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card