LXL04_000211 | RubberDandelionOmics

Gene overview

LXL04_000211

Reference: OH-1004 Chr: Chr01 Coordinates: 4132786-4135439 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · LXL04_000211|LXL04_000211|OH1004|cDNA

CGACTAGAACCCTGATTATACTCCTTTTATCGTGCAGAACATATAATTATCAGAATGACGAAGGTAAGCCCGGAAGTTTACGAAGAGACGCAAATGCAAGCTGTTTTGTCAGTATCAGCAGACGCAAGTTTCACATCAAGCAAGTTCCCAAAATACAAATTAGGTCCAGATAATCAGGTTCTCGATGACGCAACCATGGACAGTAAGGGCCCACCTCTGAAAGAAATAGTGGCCCAAGAAACCGATCAGCTATCTGAGCA...

CDS

Download CDS FASTA

1494 bp · LXL04_000211|LXL04_000211|OH1004|CDS

ATGACGAAGGTAAGCCCGGAAGTTTACGAAGAGACGCAAATGCAAGCTGTTTTGTCAGTATCAGCAGACGCAAGTTTCACATCAAGCAAGTTCCCAAAATACAAATTAGGTCCAGATAATCAGGTTCTCGATGACGCAACCATGGACAGTAAGGGCCCACCTCTGAAAGAAATAGTGGCCCAAGAAACCGATCAGCTATCTGAGCAACACAAACGTCTCTCAGTACGTGACCTCGCCAGTAAATTTGACAAGAATTTGTC...

Protein

Download Protein FASTA

497 aa · LXL04_000211|LXL04_000211|OH1004|PROTEIN

MTKVSPEVYEETQMQAVLSVSADASFTSSKFPKYKLGPDNQVLDDATMDSKGPPLKEIVAQETDQLSEQHKRLSVRDLASKFDKNLSAAAKLSNEAKLREVASLEGHVLLKKIRDALEYLRGRLAGKNKEDAEKAISMVEALAVKLTQNEGELIQEKFEVKKLANFLKQASEDAKKLVNQERSFACAEIESAKAVVRRIGEALVEQERVSLTSGKQEMEEMVEEIQQARRIRLMHQPCKVMDMEHELLALRLQIQEKSAF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_000211`
TK1151 ID	TkA01G627810
OH-1004 ID	LXL04_000211
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.700
Protein coverage (%)	TK1151 89.349 / OH-1004 30.382 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_000211

Location Chr01:4132786-4135439 (+)

Description Similar to SCAB2: Stomatal closure-related actin-binding protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g40820`	Probable plant-specific actin binding protein that bundles and stabilizes microfilaments (MFs).	No verified direct reference in this release
`At3g56480`	Probable plant-specific actin binding protein that bundles and stabilizes microfilaments (MFs).	No verified direct reference in this release
`At2g26770`	Plant-specific actin binding protein that bundles and stabilizes microfilaments (MFs).	The plant-specific actin binding protein SCAB1 stabilizes actin filaments and regulates stomatal movement in Arabidopsis.2011 · DOI: 10.1105/tpc.111.086546

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_000211 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0007015 actin filament organization Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0010119 regulation of stomatal movement Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005856 cytoskeleton Cellular Component

GO:0003779 actin binding Molecular Function

KEGG gene cross-reference

ath:AT2G26770

ath:AT2G40820

ath:AT3G56480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.516

Rank 1 · LXL04_000211 · OH-1004

Nucleus0.329

Rank 2 · LXL04_000211 · OH-1004

Cell membrane0.179

Rank 3 · LXL04_000211 · OH-1004

Golgi apparatus0.091

Rank 4 · LXL04_000211 · OH-1004

Endoplasmic reticulum0.069

Rank 5 · LXL04_000211 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16711.11SCAB-ABD55-97 aa

PF16712.11SCAB_CC101-268 aa

PF16709.12SCAB-Ig286-379 aa

PF17684.8SCAB-PH382-490 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_000211	`PF16711.11`	SCAB-ABD	55	97	2.5e-26	92.0
LXL04_000211	`PF16712.11`	SCAB_CC	101	268	3.5e-73	245.7
LXL04_000211	`PF16709.12`	SCAB-Ig	286	379	1.3e-42	144.5
LXL04_000211	`PF17684.8`	SCAB-PH	382	490	5.5e-53	178.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4IIZ9`	Arabidopsis thaliana	Stomatal closure-related actin-binding protein 2	63.765%	Swiss-Prot	strong database homology
`Q8GX05`	Arabidopsis thaliana	Stomatal closure-related actin-binding protein 3	65.112%	Swiss-Prot	strong database homology
`O48791`	Arabidopsis thaliana	Stomatal closure-related actin-binding protein 1	59.674%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card