TkAUNG098290 | RubberDandelionOmics

Gene overview

TkAUNG098290

Reference: TK1151 Chr: ChrUn Coordinates: 27763729-27765440 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1348 bp · TkAUNG098290|TK1151|cDNA

CACTTGATATCACCGATAATCCTATCAAGTCCCACATGGGTGTTTTCTGAAGTTATTATGATAGACGAACTACAAAACTTGCAATTTCTAGACGATCGATGAGCAGCAAAAATGTCAATGGCACAAATTGAAAATATGGGCACATTAAGCAGCGATCTCTTCTACGACATTCTAAAACGTCTCGATGGTGCAACCCTAGCTAGTGCATCATGCGCATGTGCAGCTTTTAGTTCAATGTCAAAAGAAGAGCGATTATGGGA...

CDS

Download CDS FASTA

1122 bp · TkAUNG098290|TK1151|CDS

ATGTCAATGGCACAAATTGAAAATATGGGCACATTAAGCAGCGATCTCTTCTACGACATTCTAAAACGTCTCGATGGTGCAACCCTAGCTAGTGCATCATGCGCATGTGCAGCTTTTAGTTCAATGTCAAAAGAAGAGCGATTATGGGAAGATGTATGTTCTTCAATGTGGCCTTCAACAAAAAGAGACGACGTCAGAAACTTGATTCTATCAATCGGCGGATTTAAAAAATTCTATGGAGATTGTTTCCCTTTAATTGT...

Protein

Download Protein FASTA

373 aa · TkAUNG098290|TK1151|PROTEIN

MSMAQIENMGTLSSDLFYDILKRLDGATLASASCACAAFSSMSKEERLWEDVCSSMWPSTKRDDVRNLILSIGGFKKFYGDCFPLIVNKEVPESRWSEYPEDYEELSEAEYYGDVDEFENVSPSDFVSMVDIKYKDKTICSKVIWGIPNANGFNGWFSNCPFRIDLFSFTGEGDDHTGGVTLSVTDGLPMVTSMERERKDGKLWKHLGDGMRLSWIVVNKKVKQAANLSSWSALTGQRHFPTDKDFLLRFGSILPAKDIL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG098290`
TK1151 ID	TkAUNG098290
OH-1004 ID	LXL04_036986
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 95.174 / OH-1004 26.394 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG098290

Location ChrUn:27763729-27765440 (-)

Description Similar to VPS11: Vacuolar protein-sorting-associated protein 11 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36090`	Probable F-box protein At2g36090.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036986 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process

GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0035542 regulation of SNARE complex assembly Biological Process

KEGG gene cross-reference

ath:AT2G05170

cel:CELE_R06F6.2

ddi:DDB_G0278141

hsa:55823

mmu:71732

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.496

Rank 1 · TkAUNG098290 · TK1151

Cytoplasm0.250

Rank 2 · TkAUNG098290 · TK1151

Endoplasmic reticulum0.173

Rank 3 · TkAUNG098290 · TK1151

Cell membrane0.169

Rank 4 · TkAUNG098290 · TK1151

Plastid0.095

Rank 5 · TkAUNG098290 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box12-50 aa

PF12937F-box-like16-53 aa

PF12937F-box-like200-207 aa

PF12937F-box-like252-265 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG098290	`PF00646`	F-box	12	50	0.018	15.7
TkAUNG098290	`PF12937`	F-box-like	16	53	0.00074	19.9
TkAUNG098290	`PF12937`	F-box-like	200	207	0.00074	19.9
TkAUNG098290	`PF12937`	F-box-like	252	265	0.00074	19.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SIH5`	Arabidopsis thaliana	sp\|Q9SIH5\|FB322_ARATH Probable F-box protein At2g36090	26.700%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card