TkAUNG098280 | RubberDandelionOmics

Gene overview

TkAUNG098280

Reference: TK1151 Chr: ChrUn Coordinates: 27757681-27762721 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3253 bp · TkAUNG098280|TK1151|cDNA

ACACGTCCTCACTCATTTCACTTTATAATTTTCACAATTTTATTTAATTTAATTTCCTCAGTGATCGATCACATATTCCCACTCCGTCTCCGATCTGCATCCCTCCGCCAGCGACGCTGCCTCCACCAGTGCCGCCGTCCACGCCCTTCACTTCCTCAAAGTCGTCTATTTTCCGGTTCTGGATTAATTTCGGCACTGAAGATCCATGTATCAATGGAGGAAATTCGAGTTCTTCGAGGAGAAATACGCCGGAAAAAGTT...

CDS

Download CDS FASTA

2772 bp · TkAUNG098280|TK1151|CDS

ATGTATCAATGGAGGAAATTCGAGTTCTTCGAGGAGAAATACGCCGGAAAAAGTTTAGTCCCGGATGAAGTCGCTGGAAAAATCGAGTGTTGCACAAGCGGAAGGGGGAAAATCGCACTTGGATGTGATGATGGCACTGTAAGTTTACTAGATCGAGGTTTCAAGTTCAGCTATGGATTCCAAGCTCACACTTCCTCTGTTTTATTCCTTCAACAACTCAAGCAACGCAACTTCCTACTAACTGTGGGAGAAGATGAACA...

Protein

Download Protein FASTA

923 aa · TkAUNG098280|TK1151|PROTEIN

MYQWRKFEFFEEKYAGKSLVPDEVAGKIECCTSGRGKIALGCDDGTVSLLDRGFKFSYGFQAHTSSVLFLQQLKQRNFLLTVGEDEQISPQLSSVCLKVFDLDKSQPEGTSTPVPDCIQILRIFTNQFPEAKITSFLALEEAPPILLIAIGLDNGCIYCIQGDIARERIKRFMLQVENRQDSKTNCCITGMGFRVDGKAFQLFAVTPTSVSLFNLQTQPAGRQTLDNIGSNVNSVAMNDRLELIIGRPEAVYFYEVDGRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG098280`
TK1151 ID	TkAUNG098280
OH-1004 ID	LXL04_036986
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.900
Protein coverage (%)	TK1151 100.000 / OH-1004 68.625 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG098280

Location ChrUn:27757681-27762721 (-)

Description Similar to VPS11: Vacuolar protein-sorting-associated protein 11 homolog

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g05170`	Involved in regulating membrane fusion at the tonoplast and the prevacuolar compartment.	The AtC-VPS protein complex is localized to the tonoplast and the prevacuolar compartment in arabidopsis.2003 · DOI: 10.1091/mbc.e02-08-0509

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036986 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006904 vesicle docking involved in exocytosis Biological Process

GO:0007032 endosome organization Biological Process

GO:0007033 vacuole organization Biological Process

GO:0008333 endosome to lysosome transport Biological Process

GO:0016192 vesicle-mediated transport Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031647 regulation of protein stability Biological Process

GO:0032889 regulation of vacuole fusion, non-autophagic Biological Process

GO:0033147 negative regulation of intracellular estrogen receptor signaling pathway Biological Process

GO:0034058 endosomal vesicle fusion Biological Process

GO:0035542 regulation of SNARE complex assembly Biological Process

KEGG gene cross-reference

ath:AT2G05170

cel:CELE_R06F6.2

ddi:DDB_G0278141

hsa:55823

mmu:71732

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkAUNG098280 · TK1151

Golgi apparatus0.323

Rank 2 · TkAUNG098280 · TK1151

Lysosome / Vacuole0.184

Rank 3 · TkAUNG098280 · TK1151

Nucleus0.177

Rank 4 · TkAUNG098280 · TK1151

Endoplasmic reticulum0.122

Rank 5 · TkAUNG098280 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23341PEP5_VPS11_N4-336 aa

PF23266VPS11_N26-331 aa

PF25171Beta-prop_WDR36-Utp21_1st29-88 aa

PF25171Beta-prop_WDR36-Utp21_1st134-219 aa

PF25171Beta-prop_WDR36-Utp21_1st317-334 aa

PF23878TPR_ELP1335-393 aa

PF28737VPS18_solenoid_2nd346-494 aa

PF13432TPR_16350-393 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG098280	`PF23341`	PEP5_VPS11_N	4	336	6.6e-90	302.3
TkAUNG098280	`PF23266`	VPS11_N	26	331	3.5e-112	375.2
TkAUNG098280	`PF25171`	Beta-prop_WDR36-Utp21_1st	29	88	4.3e-05	23.8
TkAUNG098280	`PF25171`	Beta-prop_WDR36-Utp21_1st	134	219	4.3e-05	23.8
TkAUNG098280	`PF25171`	Beta-prop_WDR36-Utp21_1st	317	334	4.3e-05	23.8
TkAUNG098280	`PF23878`	TPR_ELP1	335	393	0.2	12.6
TkAUNG098280	`PF28737`	VPS18_solenoid_2nd	346	494	6.2e-16	59.6
TkAUNG098280	`PF13432`	TPR_16	350	393	0.22	12.7
TkAUNG098280	`PF13424`	TPR_12	359	393	0.75	10.7
TkAUNG098280	`PF07719`	TPR_2	370	393	0.19	12.7
TkAUNG098280	`PF13428`	TPR_14	371	393	0.36	12.4
TkAUNG098280	`PF00515`	TPR_1	380	390	0.68	10.6
TkAUNG098280	`PF23356`	TPR_PEP5_VPS11	381	768	8.8e-86	289.0
TkAUNG098280	`PF13181`	TPR_8	381	393	8.3	7.6
TkAUNG098280	`PF23556`	TPR_Vps41	387	517	6.2e-09	36.2
TkAUNG098280	`PF00637`	Clathrin	401	539	8.6e-13	49.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJ40`	Arabidopsis thaliana	sp\|Q9SJ40\|VPS11_ARATH Vacuolar protein-sorting-associated protein 11 homolog	75.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card