TkAUNG096370 | RubberDandelionOmics

Gene overview

TkAUNG096370

Reference: TK1151 Chr: ChrUn Coordinates: 27247986-27251354 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2845 bp · TkAUNG096370|TK1151|cDNA

AGTCATTTGTGATTTTAAGTGCATTTGAATAAAGCGTTTTCAAGCCCAAATACATCAAACTGTCAGCGGGTTTCATCTCCCAGATTCGAAATTTCAAATTGAATCCTCCCTCCTTTCTCTCTCTGGTTATCTACGATCTCTGCTATGGCGACTTCCGACAATTTCATAAAAACACCCAGTAAAACACCAATGAATGATAAAGTTTCTTCGTCGGCTAGAAAACACCCTCACCATACCACCGTCTCATCATCTTCGTCTTC...

CDS

Download CDS FASTA

1125 bp · TkAUNG096370|TK1151|CDS

ATGGGCAACTGGCCAGGGATAATATCGGAAATTAAACCACCGAATGCCACCCTTCGACTTTACGGCGGTGCTGCTTTTGAGAGAGTGATGCATGAGTTCCGTTGCGCTGCTTATTCAGTCGAATGTCCACCTGTCTCAAGGGAGAAAGTCGCAAATATAATACTCGCACATGCGGGTAGAGGAGGCGGGAAGGGAATCACAGAAGCGGCGGCTGAGATCGCACGTGCGGCCGCCAGGTCATGGCTCGCTCCTCTTCTCGA...

Protein

Download Protein FASTA

374 aa · TkAUNG096370|TK1151|PROTEIN

MGNWPGIISEIKPPNATLRLYGGAAFERVMHEFRCAAYSVECPPVSREKVANIILAHAGRGGGKGITEAAAEIARAAARSWLAPLLDAACERLAFVLKNLFDLALEKNKRHRFDYGKKNGDMEGYVGFHAALRRSYNCFITDLSKQCKKLVRHHLDSVTSSYSQVCYESDLLFSANSNYRNQSAVSSMCLDLSDQENIPPENIDRETTPGKIVKAVGEASMTVPETPSPDQPRDGNYVVKKENVNFMMEGGGGRKRHHTR...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG096370`
TK1151 ID	TkAUNG096370
OH-1004 ID	LXL04_038701
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	29.500
Protein coverage (%)	TK1151 39.037 / OH-1004 19.140 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG096370

Location ChrUn:27247986-27251354 (+)

Description Similar to ARC5: Dynamin-like protein ARC5

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g53140`	Probable microtubule-associated force-producing protein that is targeted to the forming cell plate during cytokinesis.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_038701 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000281 mitotic cytokinesis Biological Process

GO:0000911 cytokinesis by cell plate formation Biological Process

GO:0007015 actin filament organization Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009739 response to gibberellin Biological Process

GO:0010020 chloroplast fission Biological Process

GO:0016559 peroxisome fission Biological Process

GO:0030835 negative regulation of actin filament depolymerization Biological Process

GO:0061952 midbody abscission Biological Process

GO:1905345 protein localization to cleavage furrow Biological Process

GO:0001891 phagocytic cup Cellular Component

GO:0005737 cytoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G53140

ath:AT3G19720

ddi:DDB_G0268592

ddi:DDB_G0271628

ddi:DDB_G0285931

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.525

Rank 1 · TkAUNG096370 · TK1151

Cytoplasm0.395

Rank 2 · TkAUNG096370 · TK1151

Mitochondrion0.070

Rank 3 · TkAUNG096370 · TK1151

Cell membrane0.068

Rank 4 · TkAUNG096370 · TK1151

Endoplasmic reticulum0.043

Rank 5 · TkAUNG096370 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24659DUF7648114-131 aa

PF24659DUF7648160-166 aa

PF14875PIP49_N160-198 aa

PF24659DUF7648271-304 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG096370	`PF24659`	DUF7648	114	131	0.073	14.0
TkAUNG096370	`PF24659`	DUF7648	160	166	0.073	14.0
TkAUNG096370	`PF14875`	PIP49_N	160	198	0.11	13.0
TkAUNG096370	`PF24659`	DUF7648	271	304	0.073	14.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4HPR5`	Arabidopsis thaliana	sp\|F4HPR5\|DRP5A_ARATH Dynamin-related protein 5A	61.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card