TkAUNG094700 | RubberDandelionOmics

Gene overview

TkAUNG094700

Reference: TK1151 Chr: ChrUn Coordinates: 26779014-26781465 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1902 bp · TkAUNG094700|TK1151|cDNA

CCAACTAATATTTTGAAGATAATAACAGTTATTCTAAAACAAAATCTAAAAGTCCTCGACGACGAAAAAAACAACTTAAACATCGTCCGATAAACCATCACACATATCGAGAGAACCCGATTGAATTTTATACAATAAATTCCTTTTTTCAATATCTTATTTGCCCGGCTAATCTTGCCGTTTTATGTTATCGTTTTATCGGTGGCGTTAGCTGTTGAATTAGTAATCGCATGGCAGAATTCAAGGTCATTGGAGTGATC...

CDS

Download CDS FASTA

906 bp · TkAUNG094700|TK1151|CDS

ATGGGCTCCGGGATAGCTCAACTGGCGGCGGTTGCCGGTGCCGATGTGCGACTACTCGACAAAGACGCCCAAGCTCTCCTCAGTGCCAAGAGATCTATCTCCGACTCTGTTCAACGTTTTGTCTCCAAAGGTCAACTCTCCAAGGTCTCGTTCTGCACTGTCTCTGAGGTAGGGGCTGACGCTGTAGCTCGTGTGAAATACACATCGAATCTAGAAGATCTCCAATCTGCAGATATAGTAATCGAAGCCATAGTTGAATC...

Protein

Download Protein FASTA

301 aa · TkAUNG094700|TK1151|PROTEIN

MGSGIAQLAAVAGADVRLLDKDAQALLSAKRSISDSVQRFVSKGQLSKVSFCTVSEVGADAVARVKYTSNLEDLQSADIVIEAIVESEDVKKKLFSELDKIVKQSAILASNTSSISITRLASATKRPHQVIGMHFMNPPPIMKLVEIIRGADTSDNTFNATKTLAERFGKTVVCSQDYAGFIVNRILMPMINEAFYTLYTGVATKEDIDAGMKLGTNQPMGPLQLADFIGLDVCLSILKVLHSGLGDPKYTPCPLLVQYV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG094700`
TK1151 ID	TkAUNG094700
OH-1004 ID	LXL04_001982
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	88.000
Protein coverage (%)	TK1151 100.000 / OH-1004 95.870 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkAUNG094700`
Location	ChrUn:26779014-26781465 (-)
Description	Similar to hbdA: 3-hydroxybutyryl-CoA dehydrogenase (Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_001982` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006635 fatty acid beta-oxidation Biological Process GO:0019605 butyrate metabolic process Biological Process GO:0030435 sporulation resulting in formation of a cellular spore Biological Process GO:0008691 3-hydroxybutyryl-CoA dehydrogenase activity Molecular Function GO:0016491 oxidoreductase activity Molecular Function GO:0070403 NAD+ binding Molecular Function
KEGG gene cross-reference	bja:blr1379 bsu:BSU24160 cac:CA_C2708 dra:DR_1068 ttm:Tthe_1657 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.653

Rank 1 · TkAUNG094700 · TK1151

Nucleus0.243

Rank 2 · TkAUNG094700 · TK1151

Mitochondrion0.144

Rank 3 · TkAUNG094700 · TK1151

Plastid0.091

Rank 4 · TkAUNG094700 · TK1151

Peroxisome0.079

Rank 5 · TkAUNG094700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF027373HCDH_N1-177 aa

PF01656CbiA4-186 aa

PF007253HCDH6-46 aa

PF007253HCDH56-65 aa

PF11965DUF347965-123 aa

PF007253HCDH180-269 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG094700	`PF02737`	3HCDH_N	1	177	1.2e-57	195.4
TkAUNG094700	`PF01656`	CbiA	4	186	0.06	14.0
TkAUNG094700	`PF00725`	3HCDH	6	46	1.1e-30	106.7
TkAUNG094700	`PF00725`	3HCDH	56	65	1.1e-30	106.7
TkAUNG094700	`PF11965`	DUF3479	65	123	0.04	14.8
TkAUNG094700	`PF00725`	3HCDH	180	269	1.1e-30	106.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card