TkAUNG094220 | RubberDandelionOmics

Gene overview

TkAUNG094220

Reference: TK1151 Chr: ChrUn Coordinates: 26642766-26644600 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1435 bp · TkAUNG094220|TK1151|cDNA

CTTTCATCTTTTTATCACTAGAGGAGCTTCTACATACACTTATAGTCGATCTAGGTCCTGTGGCTCCACCAAAATGGCTAATCCACTAGAAATGTTGGAAGCCTCATGCACCAGACTGGTCCGTAGAATGGTTAGCCTCCCCCGAGCCATAATGGGTCAAGGACTAGACCTCATGAGAAACCACCACCAATTTCCGACACCAAATCCTCCTGTCTACCACCACCCTCCGCCACAAGATCACTCCATTTCCAATCACCTTC...

CDS

Download CDS FASTA

1011 bp · TkAUNG094220|TK1151|CDS

ATGGCTAATCCACTAGAAATGTTGGAAGCCTCATGCACCAGACTGGTCCGTAGAATGGTTAGCCTCCCCCGAGCCATAATGGGTCAAGGACTAGACCTCATGAGAAACCACCACCAATTTCCGACACCAAATCCTCCTGTCTACCACCACCCTCCGCCACAAGATCACTCCATTTCCAATCACCTTCAACCGAATTTGGGGTTTCTTGCAAGTTTTGAGCAACAATTTGGAACCACACATCCGTTTTTCTACGCATGTAG...

Protein

Download Protein FASTA

336 aa · TkAUNG094220|TK1151|PROTEIN

MANPLEMLEASCTRLVRRMVSLPRAIMGQGLDLMRNHHQFPTPNPPVYHHPPPQDHSISNHLQPNLGFLASFEQQFGTTHPFFYACRFMEVLKMARDEHKFVFLYLHMPNHPFTPHFCTETLCSEVVVEFLDANFVSWGGGVDQGEGLHLATTLRPVSYPFCAVVAPGLGHNLDVVQQMEGPVTPEELVEILQTILEGSVFGNERAQAEEKRLADLRLIQEQDAAYSASLKVDQDREKVLKLGKETQDEANASANGQHSQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG094220`
TK1151 ID	TkAUNG094220
OH-1004 ID	LXL04_031873
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.400
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG094220

Location ChrUn:26642766-26644600 (-)

Description Similar to PUX10: Plant UBX domain-containing protein 10

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g10790`	Plant UBX domain-containing protein 10.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031873 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006986 response to unfolded protein Biological Process

GO:0030970 retrograde protein transport, ER to cytosol Biological Process

GO:0034389 lipid droplet organization Biological Process

GO:0035617 stress granule disassembly Biological Process

GO:0036503 ERAD pathway Biological Process

GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Biological Process

GO:1905691 lipid droplet disassembly Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005811 lipid droplet Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT4G10790

bta:767948

hsa:23197

xla:443943

xtr:734096

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.459

Rank 1 · TkAUNG094220 · TK1151

Nucleus0.261

Rank 2 · TkAUNG094220 · TK1151

Endoplasmic reticulum0.244

Rank 3 · TkAUNG094220 · TK1151

Golgi apparatus0.121

Rank 4 · TkAUNG094220 · TK1151

Mitochondrion0.119

Rank 5 · TkAUNG094220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF21021FAF168-139 aa

PF00789UBX97-122 aa

PF02290SRP14236-280 aa

PF00789UBX256-334 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG094220	`PF21021`	FAF1	68	139	5e-11	43.2
TkAUNG094220	`PF00789`	UBX	97	122	1.7e-16	60.9
TkAUNG094220	`PF02290`	SRP14	236	280	0.11	13.6
TkAUNG094220	`PF00789`	UBX	256	334	1.7e-16	60.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M0N1`	Arabidopsis thaliana	sp\|Q9M0N1\|PUX10_ARATH Plant UBX domain-containing protein 10	38.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card