TkAUNG093830 | RubberDandelionOmics

Gene overview

TkAUNG093830

Reference: TK1151 Chr: ChrUn Coordinates: 26550149-26550591 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

303 bp · TkAUNG093830|TK1151|cDNA

ATGCCTTATATGTCATTAACCAATCATCACCAAAGTAATAGGGATATTTCCAGTACTCAACCACGGTTAAATGTATCCCACAGACTGGCTTCATTAATGAGATTTCGTGAAAAGAGGAAAGAACGGAATTTTGAGAAGAAAATCCGTTACACTGTTCGCAAGGAAGTGGCACTCAGGATGCAACGAAATAAAGGCCAATTCACTTCCTCAATACCTGTTAATGAAGATTCTGCTACAAGTTGGGAGTCGAACCAAGGGTG...

CDS

Download CDS FASTA

303 bp · TkAUNG093830|TK1151|CDS

ATGCCTTATATGTCATTAACCAATCATCACCAAAGTAATAGGGATATTTCCAGTACTCAACCACGGTTAAATGTATCCCACAGACTGGCTTCATTAATGAGATTTCGTGAAAAGAGGAAAGAACGGAATTTTGAGAAGAAAATCCGTTACACTGTTCGCAAGGAAGTGGCACTCAGGATGCAACGAAATAAAGGCCAATTCACTTCCTCAATACCTGTTAATGAAGATTCTGCTACAAGTTGGGAGTCGAACCAAGGGTG...

Protein

Download Protein FASTA

100 aa · TkAUNG093830|TK1151|PROTEIN

MPYMSLTNHHQSNRDISSTQPRLNVSHRLASLMRFREKRKERNFEKKIRYTVRKEVALRMQRNKGQFTSSIPVNEDSATSWESNQGWQSDGSGSRHQETA

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG093830`
TK1151 ID	TkAUNG093830
OH-1004 ID	LXL04_009136
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	94.000
Protein coverage (%)	TK1151 100.000 / OH-1004 34.014 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG093830

Location ChrUn:26550149-26550591 (+)

Description Similar to GATA28: GATA transcription factor 28

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g51600`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	Characterization of Arabidopsis ZIM, a member of a novel plant-specific GATA factor gene family.2004 · DOI: 10.1093/jxb/erh078
`At3g21175`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	Characterization of Arabidopsis ZIM, a member of a novel plant-specific GATA factor gene family.2004 · DOI: 10.1093/jxb/erh078

Rice

Reference gene ID	Possible function	Papers / DOI
`Os06g0698900`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`Os02g0148500`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release
`UniProt: A2XKR7`	Transcriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_009136 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

GO:0042802 identical protein binding Molecular Function

GO:0043565 sequence-specific DNA binding Molecular Function

KEGG gene cross-reference

ath:AT1G51600

ath:AT3G21175

dosa:Os02g0148500

dosa:Os06g0698900

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.716

Rank 1 · TkAUNG093830 · TK1151

Cytoplasm0.345

Rank 2 · TkAUNG093830 · TK1151

Mitochondrion0.045

Rank 3 · TkAUNG093830 · TK1151

Cell membrane0.043

Rank 4 · TkAUNG093830 · TK1151

Endoplasmic reticulum0.019

Rank 5 · TkAUNG093830 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06203CCT28-69 aa

PF09425Jas_motif28-50 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG093830	`PF06203`	CCT	28	69	4e-17	62.7
TkAUNG093830	`PF09425`	Jas_motif	28	50	3.5e-08	33.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8H1G0`	Arabidopsis thaliana	sp\|Q8H1G0\|GAT28_ARATH GATA transcription factor 28	60.600%	Swiss-Prot	High
`Q8GXL7`	Arabidopsis thaliana	sp\|Q8GXL7\|GAT24_ARATH GATA transcription factor 24	63.200%	Swiss-Prot	High
`Q5Z4U5`	Oryza sativa subsp. japonica	sp\|Q5Z4U5\|GAT20_ORYSJ GATA transcription factor 20	81.400%	Swiss-Prot	Medium
`Q6Z433`	Oryza sativa subsp. japonica	sp\|Q6Z433\|GAT17_ORYSJ GATA transcription factor 17	69.200%	Swiss-Prot	Medium
`A2XKR7`	Oryza sativa subsp. indica	sp\|A2XKR7\|GAT18_ORYSI GATA transcription factor 18	87.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card