TkAUNG092360 | RubberDandelionOmics

Gene overview

TkAUNG092360

Reference: TK1151 Chr: ChrUn Coordinates: 26173842-26177319 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2135 bp · TkAUNG092360|TK1151|cDNA

TTTTGAACGAAAAAGTGACTCTTCATTTTAAAATAGAGGAAGCGAAGAAAAAGTAAAAGATATACGTATAACTTCTCGTATATTTATATCACAAACAACATACGGAGTAATAAAAAGTCTCAGCTTTGTTCCTCTCTCCAGAATTAAAAACCTCTGAGAGAGTGTCTGCCTCTGCTCCTACCGGCGCTGCCACTCCTTTTCCACCTCTCTCGGTCGCCGCCTTTCTGCAGAAAATTTGGTAAAGGAGCAAGCGCATTCAA...

CDS

Download CDS FASTA

1431 bp · TkAUNG092360|TK1151|CDS

ATGTTTGGTGAAAAGCAAGCTGAGGAGTCAATAGTTCCATCGAACGAAAATGGAGAAAGAGGCGGGAAAGAAGGAGATGGAGAATCAGAAGATCACTCTGTTTTCAGTATGAAAAATGCGCTATGGCATGGAGGCTCTGCTTGGGATGCTTGGTTTAGTTGTTCGTCAAATCAAGTGGCGCAAGTGCTATTAACCTTGCCATACTCGTTCTCTCAATTAGGGATGGTTTCAGGGATTGTTCTTCAGATCTTCTATGGTCT...

Protein

Download Protein FASTA

476 aa · TkAUNG092360|TK1151|PROTEIN

MFGEKQAEESIVPSNENGERGGKEGDGESEDHSVFSMKNALWHGGSAWDAWFSCSSNQVAQVLLTLPYSFSQLGMVSGIVLQIFYGLLGSWTAYLISVLYVEYRARKEKENVNFKNHVIQWFEVLDGLLGPYWKAIGLAFNCTFLLFGSVIQLIACASNIYYINDHLDKRTWTYIFGACCATTVFIPSFHNYRIWSFLGLFMTTYTAWYMAIAALIHGQVDGVEHSAPQKLVLYFTGATNILYTFGGHAVTVEIMHAMWK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG092360`
TK1151 ID	TkAUNG092360
OH-1004 ID	LXL04_019129
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	99.800
Protein coverage (%)	TK1151 96.008 / OH-1004 85.261 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG092360

Location ChrUn:26173842-26177319 (+)

Description Similar to LAX4: Auxin transporter-like protein 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g38120`	Carrier protein involved in proton-driven auxin influx.	Auxin and ethylene promote root hair elongation in Arabidopsis.1998 · DOI: 10.1046/j.1365-313x.1998.00321.x AUX1 regulates root gravitropism in Arabidopsis by facilitating auxin uptake within root apical tissues.1999 · DOI: 10.1093/emboj/18.8.2066 Auxin is a positive regulator for ethylene-mediated response in the growth of Arabidopsis roots.2001 · DOI: 10.1093/pcp/pce035 The AXR1 and AUX1 genes of Arabidopsis function in separate auxin-response pathways.1995 · DOI: 10.1046/j.1365-313x.1995.8040561.x Localization of the auxin permease AUX1 suggests two functionally distinct hormone transport pathways operate in the Arabidopsis root apex.2001 · DOI: 10.1101/gad.210501 Cell polarity signaling in Arabidopsis involves a BFA-sensitive auxin influx pathway.2002 · DOI: 10.1016/s0960-9822(02)00654-1 AUX1 promotes lateral root formation by facilitating indole-3-acetic acid distribution between sink and source tissues in the Arabidopsis seedling.2002 · DOI: 10.1105/tpc.010354 Auxin and ethylene response interactions during Arabidopsis root hair development dissected by auxin influx modulators.2002 · DOI: 10.1104/pp.010546 Structure-function analysis of the presumptive Arabidopsis auxin permease AUX1.2004 · DOI: 10.1105/tpc.104.024737 The aux1 Mutation of Arabidopsis Confers Both Auxin and Ethylene Resistance.1990 · DOI: 10.1104/pp.94.3.1462 Genetic analysis of ethylene signal transduction in Arabidopsis thaliana: five novel mutant loci integrated into a stress response pathway.1995 · DOI: 10.1093/genetics/139.3.1393 Ammonium inhibition of Arabidopsis root growth can be reversed by potassium and by auxin resistance mutations aux1, axr1, and axr2.1993 · DOI: 10.1104/pp.102.3.983 Arabidopsis AUX1 gene: a permease-like regulator of root gravitropism.1996 · DOI: 10.1126/science.273.5277.948 Genetic analysis of the effects of polar auxin transport inhibitors on root growth in Arabidopsis thaliana.1996 · DOI: 10.1093/oxfordjournals.pcp.a029059 The Arabidopsis AUX1 gene: a model system to study mRNA processing in plants.1998 · DOI: 10.1023/a:1005961303167 Differential effects of 1-naphthaleneacetic acid, indole-3-acetic acid and 2,4-dichlorophenoxyacetic acid on the gravitropic response of roots in an auxin-resistant mutant of arabidopsis, aux1.1998 · DOI: 10.1093/oxfordjournals.pcp.a029419
`At5g01240`	Carrier protein involved in proton-driven auxin influx.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0856500`	Carrier protein involved in proton-driven auxin influx.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019129 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0003333 amino acid transmembrane transport Biological Process

GO:0006865 amino acid transport Biological Process

GO:0009624 response to nematode Biological Process

GO:0009734 auxin-activated signaling pathway Biological Process

GO:0009926 auxin polar transport Biological Process

GO:0009958 positive gravitropism Biological Process

GO:0010262 somatic embryogenesis Biological Process

GO:0010311 lateral root formation Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048829 root cap development Biological Process

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT2G38120

ath:AT5G01240

dosa:Os01g0856500

mtr:11407085

mtr:25494399

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.785

Rank 1 · TkAUNG092360 · TK1151

Cytoplasm0.126

Rank 2 · TkAUNG092360 · TK1151

Endoplasmic reticulum0.082

Rank 3 · TkAUNG092360 · TK1151

Lysosome / Vacuole0.062

Rank 4 · TkAUNG092360 · TK1151

Golgi apparatus0.055

Rank 5 · TkAUNG092360 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01490Aa_trans43-436 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG092360	`PF01490`	Aa_trans	43	436	5.9e-89	299.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q96247`	Arabidopsis thaliana	sp\|Q96247\|AUX1_ARATH Auxin transporter protein 1	89.200%	Swiss-Prot	High
`Q9LFB2`	Arabidopsis thaliana	sp\|Q9LFB2\|LAX1_ARATH Auxin transporter-like protein 1	84.300%	Swiss-Prot	High
`Q5N892`	Oryza sativa subsp. japonica	sp\|Q5N892\|LAX11_ORYSJ Auxin transporter-like protein 1	83.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card