TkAUNG091340 | RubberDandelionOmics

Gene overview

TkAUNG091340

Reference: TK1151 Chr: ChrUn Coordinates: 25870408-25872151 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1025 bp · TkAUNG091340|TK1151|cDNA

GGGTAAGAAAACAGCTCGTTTGTTGATTTTACTTGTTATAAACATATCCCTTAAACCCTAGCTTTAATAACCAACGATTCAAGCCTAAAGATGAGCAATGAAAAGTAATAAACAGGTGTTGATTCTAGATCAAGTAAGATGATGGCTTCGACTTTAGGTTCAAGTTCTTCCACTCTATCCGATGTTTCTCAGTTTTATCACACCCCTTCTTACTGCGAAGAAAATGTATACTTGCTCTGCAAGAAACTCTGTGCAGATGG...

CDS

Download CDS FASTA

669 bp · TkAUNG091340|TK1151|CDS

ATGATGGCTTCGACTTTAGGTTCAAGTTCTTCCACTCTATCCGATGTTTCTCAGTTTTATCACACCCCTTCTTACTGCGAAGAAAATGTATACTTGCTCTGCAAGAAACTCTGTGCAGATGGAGTTGCTGATGTTTCTGATCTCTTCGTTGTCTTCATTTCCAATGAGCATAAGCATGTACCATTGTGGCATCAGAAAGCTAGCCACAGAGCTGATGGGATAATTTTATGGGATTACCATGTGGTTTGCATTCAGAGAGG...

Protein

Download Protein FASTA

222 aa · TkAUNG091340|TK1151|PROTEIN

MMASTLGSSSSTLSDVSQFYHTPSYCEENVYLLCKKLCADGVADVSDLFVVFISNEHKHVPLWHQKASHRADGIILWDYHVVCIQRGKEGKSDVVWDLDSSLPFPSTLPSYVSESIRPSFELFSEFQRVFRIVHAPIFLRNFASDRRHMKDSEGNWMATPPVHEVIVAEDGSVHNLNQYMDMSTKDVLKDLEKDSINEVFTKQFGLLVGESHFQQFFSSISL

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG091340`
TK1151 ID	TkAUNG091340
OH-1004 ID	LXL04_036259
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	99.500
Protein coverage (%)	TK1151 89.189 / OH-1004 11.633 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG091340

Location ChrUn:25870408-25872151 (-)

Description Similar to Tf2-9: Transposon Tf2-9 polyprotein (Schizosaccharomyces pombe (strain 972 / ATCC 24843)

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g41760`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	Distinct branches of the N-end rule pathway modulate the plant immune response.2019 · DOI: 10.1111/nph.15387

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AXU2`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	No verified direct reference in this release
`Os05g0387900`	Mediates the side-chain deamidation of N-terminal glutamine residues to glutamate, an important step in N-end rule pathway of protein degradation.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036259 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006310 DNA recombination Biological Process

GO:0006508 proteolysis Biological Process

GO:0015074 DNA integration Biological Process

GO:0005634 nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

GO:0003723 RNA binding Molecular Function

GO:0003887 DNA-directed DNA polymerase activity Molecular Function

GO:0003964 RNA-directed DNA polymerase activity Molecular Function

GO:0004190 aspartic-type endopeptidase activity Molecular Function

GO:0004519 endonuclease activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

spo:2542672

spo:2542797

spo:2543673

spo:3361218

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.702

Rank 1 · TkAUNG091340 · TK1151

Nucleus0.432

Rank 2 · TkAUNG091340 · TK1151

Mitochondrion0.059

Rank 3 · TkAUNG091340 · TK1151

Cell membrane0.055

Rank 4 · TkAUNG091340 · TK1151

Golgi apparatus0.055

Rank 5 · TkAUNG091340 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF09764Nt_Gln_amidase21-217 aa

PF10684BDM166-204 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG091340	`PF09764`	Nt_Gln_amidase	21	217	9.5e-66	221.6
TkAUNG091340	`PF10684`	BDM	166	204	0.14	13.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22944`	Arabidopsis thaliana	sp\|O22944\|NTAQ1_ARATH Protein N-terminal glutamine amidohydrolase	59.300%	Swiss-Prot	High
`B8AXU2`	Oryza sativa subsp. indica	sp\|B8AXU2\|NTAQ1_ORYSI Protein N-terminal glutamine amidohydrolase	56.200%	Swiss-Prot	High
`Q60E61`	Oryza sativa subsp. japonica	sp\|Q60E61\|NTAQ1_ORYSJ Protein N-terminal glutamine amidohydrolase	55.700%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card