TkAUNG089580 | RubberDandelionOmics

Gene overview

TkAUNG089580

Reference: TK1151 Chr: ChrUn Coordinates: 25435033-25439613 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1867 bp · TkAUNG089580|TK1151|cDNA

AAAGAAGTCAAAACTAATTCCTGATAAATTCAAGGGATAAACTCCAACCTTGTGAAAGCTAATCAATCAATATCCATTTATACTATTCACGTTTTTTCGGTGATCCTTTTGTCGACTTCCTCCTATACACAAACTACGCAGAGAGAAATCGATCAATCAATGGCCATACACGAAGATCTTCTGGTTCCAATCCACTCCAAACTTGATGAGGTTTACGGTGATGGATCACAGCTCGAAGAAGCTCAACTTCGATTCTCCAT...

CDS

Download CDS FASTA

1206 bp · TkAUNG089580|TK1151|CDS

ATGGCCATACACGAAGATCTTCTGGTTCCAATCCACTCCAAACTTGATGAGGTTTACGGTGATGGATCACAGCTCGAAGAAGCTCAACTTCGATTCTCCATTCTCAACTCTAAATTCAAAGAATTATTCGGTCATCTTCCTGACATCTATGCTCGCGCTCCAGGAAGAGTGAATTTAATTGGAGAACACATTGACTATGAGGGATATTCAGTGTTGCCCATGGCAATTAGGCAAGACACAATTGTAGCCATTCGGAAACG...

Protein

Download Protein FASTA

401 aa · TkAUNG089580|TK1151|PROTEIN

MAIHEDLLVPIHSKLDEVYGDGSQLEEAQLRFSILNSKFKELFGHLPDIYARAPGRVNLIGEHIDYEGYSVLPMAIRQDTIVAIRKRDAGESEKLLRIANVNDKYTMCTYPVDPDQEIDLKNHRWGHYFICGYKGFHEYAKSVGLDVGSPVGLDVIIDGTVPTGSGLSSSAAFVCSSTIAIMAALNVNLPKKEVAQLTCECERHIGTQSGGMDQAISIMAKTGFAELIDFNPIRATDVQLPAGGSFVIAHSLAESQKAVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG089580`
TK1151 ID	TkAUNG089580
OH-1004 ID	LXL04_015369
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	98.000
Protein coverage (%)	TK1151 99.252 / OH-1004 79.760 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG089580

Location ChrUn:25435033-25439613 (+)

Description Similar to GAL1: Galactokinase

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g06580`	Sugar-1-kinase with a very high substrate specificity for the alpha-anomeric configuration of D-galacose (D-Gal).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_015369 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005975 carbohydrate metabolic process Biological Process

GO:0006012 galactose metabolic process Biological Process

GO:0019388 galactose catabolic process Biological Process

GO:0046835 carbohydrate phosphorylation Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0004335 galactokinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0033858 N-acetylgalactosamine kinase activity Molecular Function

GO:0046872 metal ion binding Molecular Function

KEGG gene cross-reference

ath:AT3G06580

ddi:DDB_G0292112

hsa:2585

mmu:69976

rno:296117

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.825

Rank 1 · TkAUNG089580 · TK1151

Nucleus0.345

Rank 2 · TkAUNG089580 · TK1151

Peroxisome0.082

Rank 3 · TkAUNG089580 · TK1151

Mitochondrion0.069

Rank 4 · TkAUNG089580 · TK1151

Endoplasmic reticulum0.035

Rank 5 · TkAUNG089580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF10509GalKase_gal_bdg38-86 aa

PF00288GHMP_kinases_N144-220 aa

PF22700MVD-like_N158-197 aa

PF22700MVD-like_N235-264 aa

PF00288GHMP_kinases_N322-343 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG089580	`PF10509`	GalKase_gal_bdg	38	86	9.5e-24	83.4
TkAUNG089580	`PF00288`	GHMP_kinases_N	144	220	6.5e-17	62.2
TkAUNG089580	`PF22700`	MVD-like_N	158	197	0.011	16.1
TkAUNG089580	`PF22700`	MVD-like_N	235	264	0.011	16.1
TkAUNG089580	`PF00288`	GHMP_kinases_N	322	343	6.5e-17	62.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SEE5`	Arabidopsis thaliana	sp\|Q9SEE5\|GALK1_ARATH Galactokinase	75.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card