Gene Card
Gene overview
cDNA / CDS / Protein Sequences
737 bp · TkAUNG084880|TK1151|cDNA
CGTGTGCATGCAAGCATCCAAACAACATAAAGCAAACTCACTTGATCACTCCAGTGAGATATTATACTCGGAATGACTGCTTTTGATGATTCTCTTTCAGTCGCATCCAAATCTACTTCACACAAAGAGCATCATGACCCAGAAAAGGACAATCTAGCCCACCTCTTGGACAAATACAAGGATAGGTTAACCACACTACCCAAACAAAAAGGGTGGATGGGTGAAAACTTATACTTGTATCAAGGCTTTTGGTACCGCTC...
318 bp · TkAUNG084880|TK1151|CDS
ATGACTGCTTTTGATGATTCTCTTTCAGTCGCATCCAAATCTACTTCACACAAAGAGCATCATGACCCAGAAAAGGACAATCTAGCCCACCTCTTGGACAAATACAAGGATAGGTTAACCACACTACCCAAACAAAAAGGGTGGATGGGTGAAAACTTATACTTGTATCAAGGCTTTTGGTACCGCTCTTACGACCCATTCTCAGTTCAGATGACCATGGCCCTGCAAGATTCTTACCAACCTCATCCTGCTAATATCTA...
Protein
Download Protein FASTA105 aa · TkAUNG084880|TK1151|PROTEIN
MTAFDDSLSVASKSTSHKEHHDPEKDNLAHLLDKYKDRLTTLPKQKGWMGENLYLYQGFWYRSYDPFSVQMTMALQDSYQPHPANIYLEPERCFGVLVLLFKQAH
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG084880 |
|---|---|
| TK1151 ID | TkAUNG084880 |
| OH-1004 ID | LXL04_006261 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 95.500 |
| Protein coverage (%) | TK1151 83.810 / OH-1004 25.360Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG084880 |
|---|---|
| Location | ChrUn:24132758-24134152 (-) |
| Description | Similar to SOT13: Cytosolic sulfotransferase 13 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006952 defense response Biological Process GO:0009651 response to salt stress Biological Process GO:0009751 response to salicylic acid Biological Process GO:0009806 lignan metabolic process Biological Process GO:0009812 flavonoid metabolic process Biological Process GO:0016131 brassinosteroid metabolic process Biological Process GO:0019761 glucosinolate biosynthetic process Biological Process GO:0032260 response to jasmonic acid stimulus involved in jasmonic acid and ethylene-dependent systemic resistance Biological Process GO:0051923 sulfation Biological Process GO:0005634 nucleus Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component |
| KEGG gene cross-reference | ath:AT1G74100 ath:AT2G03750 ath:AT2G03760 ath:AT2G03770 ath:AT3G45070 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF27117FliB_C20-70 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG084880 | PF27117 | FliB_C | 20 | 70 | 0.25 | 12.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.