TkAUNG084590 | RubberDandelionOmics

Gene overview

TkAUNG084590

Reference: TK1151 Chr: ChrUn Coordinates: 24067492-24070546 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2191 bp · TkAUNG084590|TK1151|cDNA

ATACGACATTTGGACCATTTGGTATATAGCTCCCTCGCCCCCTTTTCACAGACAGCCCCACAATTTCGCAGTAGCAAAAATGCGCAACCGGAGGTACCTAGCCTCCAGCGACGACGAGGAAGACGACGCGCCTCCGCAGCCAACACCGGAAATGAGGTCTAGTCAGCGGAAGAGAAAGAGGATGAAATTTTATGAAGACGATGACGAAGAAGAAGGAGAAGAAGAAGCAATTAAACAAGTAGCTAAAATGAAACGAGACA...

CDS

Download CDS FASTA

1791 bp · TkAUNG084590|TK1151|CDS

ATGCGCAACCGGAGGTACCTAGCCTCCAGCGACGACGAGGAAGACGACGCGCCTCCGCAGCCAACACCGGAAATGAGGTCTAGTCAGCGGAAGAGAAAGAGGATGAAATTTTATGAAGACGATGACGAAGAAGAAGGAGAAGAAGAAGCAATTAAACAAGTAGCTAAAATGAAACGAGACAATAAAAAATCCAAGGGCGATGAAGAGGAAGAGAAAGAAGCTTCGCCGCCGCCTGAGGAAGAGGAAGAAGAAGAAGAAGA...

Protein

Download Protein FASTA

596 aa · TkAUNG084590|TK1151|PROTEIN

MRNRRYLASSDDEEDDAPPQPTPEMRSSQRKRKRMKFYEDDDEEEGEEEAIKQVAKMKRDNKKSKGDEEEEKEASPPPEEEEEEEEEAPVEDAKPIGEVVRVSGKGKTRRNHYKSFEFDGLSYELEDPVLLVPDPEGPNKKPYVAIIKDVTETKDGSVMVTGQWFYRPEEAEKKNGGNWQSSDTRELFYSFHRDEVPAESVMHKCVVHFIPAHKQIPSRKLHPGFIVQKVYDTIFKRLFKLTDKDYEDNMQHEIDLLVQK...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG084590`
TK1151 ID	TkAUNG084590
OH-1004 ID	LXL04_005576
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.000
Protein coverage (%)	TK1151 83.054 / OH-1004 82.363 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG084590

Location ChrUn:24067492-24070546 (-)

Description Similar to EBS: Chromatin remodeling protein EBS

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11560`	Transcriptional repressor.	A protein complex regulates RNA processing of intronic heterochromatin-containing genes in Arabidopsis .2017 · DOI: 10.1073/pnas.1710683114 Coupling of H3K27me3 recognition with transcriptional repression through the BAH-PHD-CPL2 complex in Arabidopsis.2020 · DOI: 10.1038/s41467-020-20089-0 A histone H3K27me3 reader cooperates with a family of PHD finger-containing proteins to regulate flowering time in Arabidopsis.2021 · DOI: 10.1111/jipb.13067

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005576 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0009791 post-embryonic development Biological Process

GO:0009845 seed germination Biological Process

GO:0009908 flower development Biological Process

GO:0010220 positive regulation of vernalization response Biological Process

GO:0034244 negative regulation of transcription elongation by RNA polymerase II Biological Process

GO:0045814 negative regulation of gene expression, epigenetic Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:2000028 regulation of photoperiodism, flowering Biological Process

GO:0005634 nucleus Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0001217 DNA-binding transcription repressor activity Molecular Function

KEGG gene cross-reference

ath:AT4G04260

ath:AT4G22140

bdi:100843157

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.966

Rank 1 · TkAUNG084590 · TK1151

Cytoplasm0.078

Rank 2 · TkAUNG084590 · TK1151

Cell membrane0.031

Rank 3 · TkAUNG084590 · TK1151

Endoplasmic reticulum0.018

Rank 4 · TkAUNG084590 · TK1151

Plastid0.012

Rank 5 · TkAUNG084590 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07500TFIIS_M24-40 aa

PF01426BAH42-65 aa

PF05416Peptidase_C3750-124 aa

PF01426BAH122-241 aa

PF07500TFIIS_M229-250 aa

PF07500TFIIS_M345-467 aa

PF27511ComFA_N432-514 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG084590	`PF07500`	TFIIS_M	24	40	1.4e-16	61.7
TkAUNG084590	`PF01426`	BAH	42	65	3.1e-19	69.8
TkAUNG084590	`PF05416`	Peptidase_C37	50	124	0.34	10.2
TkAUNG084590	`PF01426`	BAH	122	241	3.1e-19	69.8
TkAUNG084590	`PF07500`	TFIIS_M	229	250	1.4e-16	61.7
TkAUNG084590	`PF07500`	TFIIS_M	345	467	1.4e-16	61.7
TkAUNG084590	`PF27511`	ComFA_N	432	514	0.11	13.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RXT5`	Arabidopsis thaliana	sp\|Q8RXT5\|AIPP3_ARATH ASI1-immunoprecipitated protein 3	56.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card