Gene Card
Gene overview
cDNA / CDS / Protein Sequences
7619 bp · TkAUNG083930|TK1151|cDNA
GACAGGTGCGAACCGCCTTAACCCTCTTTATTTAGGCCGCTGTTTTTCCTCGTTTCTATTTTTCCTCATATCGACTGAGGGTCTCACTCCGTATCGGGACAGATCCAAAACCCTAGCCACCGCCATTGAACCTCTCGGAACACCTCTCTAGATTTCCCTCCCTTCATTTTCAATCTCAACTCATCTACAACAAAATTCCCACGAGAGATAGGTCGGTTTATTTCGTTGAAATTACTAGGGTTTATGGTTAGGTTTTAGGA...
7110 bp · TkAUNG083930|TK1151|CDS
ATGTGGAATAGTAACAACGGGCAAGAGATGTGGAATAACAACGGTATGATTGCCCCTCCTGGAACTGGTGGAGTACCACCGCTAGCGCCTCCGGGGACTGGAGGTGCTGGTGGCTCAATACCACCGCCGCCTGCTGCGCAACCTTCCTACACTGTTCTGCCGTCTCCAGCTGAAGCGGAGGCGAGGTTGGAAGAAAAAGCGAGGAAATGGATGCAGTTGAACTCGAAGCGATATGGAGATAAACGGAAATTTGGTTTCGT...
Protein
Download Protein FASTA2369 aa · TkAUNG083930|TK1151|PROTEIN
MWNSNNGQEMWNNNGMIAPPGTGGVPPLAPPGTGGAGGSIPPPPAAQPSYTVLPSPAEAEARLEEKARKWMQLNSKRYGDKRKFGFVETQKEDMPPEHVRKIIRDHGDMSSKKYRHDKRVYLGALKFVPHAVYKLLENMPMPWEQVRDVKVLYHITGAITFVNEIPWVVEPIYLAQWGTMWIMMRREKRDRRHFKRMRFPPFDDEEPPLDYADNLLDVDPLEPIQLDLEEDEDSAVYTWFYDHKPLVKTKLINGPSYRKW...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkAUNG083930 |
|---|---|
| TK1151 ID | TkAUNG083930 |
| OH-1004 ID | LXL04_032063 |
| Relationship / confidence | Multi Source To Oh1004 / Complex relationship |
| Protein identity (%) | 100.000 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkAUNG083930 | |||||||||
|---|---|---|---|---|---|---|---|---|---|---|
| Location | ChrUn:23872165-23881846 (-) | |||||||||
| Description | Similar to PRP8A: Pre-mRNA-processing-splicing factor 8A | |||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
RiceNo hit for this species in the current source table. | |||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | |||||||||
| GO annotations (OH1004 source) | GO:0000244 spliceosomal tri-snRNP complex assembly Biological Process GO:0000375 RNA splicing, via transesterification reactions Biological Process GO:0000380 alternative mRNA splicing, via spliceosome Biological Process GO:0000387 spliceosomal snRNP assembly Biological Process GO:0000388 spliceosome conformational change to release U4 (or U4atac) and U1 (or U11) Biological Process GO:0000393 spliceosomal conformational changes to generate catalytic conformation Biological Process GO:0000398 mRNA splicing, via spliceosome Biological Process GO:0006397 mRNA processing Biological Process GO:0008380 RNA splicing Biological Process GO:0045292 mRNA cis splicing, via spliceosome Biological Process GO:0048025 negative regulation of mRNA splicing, via spliceosome Biological Process GO:0071222 cellular response to lipopolysaccharide Biological Process | |||||||||
| KEGG gene cross-reference | ath:AT1G80070 ath:AT4G38780 cel:CELE_C50C3.6 hsa:10594 mmu:192159 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF08082PRO8NT91-242 aaPF08083PROCN429-834 aaPF15233SYCE1500-586 aaPF08082PRO8NT723-748 aaPF10598RRM_41019-1109 aaPF10597U5_2-snRNA_bdg1271-1406 aaPF10596U6-snRNA_bdg1476-1634 aaPF15233SYCE11625-1653 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkAUNG083930 | PF08082 | PRO8NT | 91 | 242 | 2.2e-84 | 281.7 |
| TkAUNG083930 | PF08083 | PROCN | 429 | 834 | 3.5e-236 | 784.2 |
| TkAUNG083930 | PF15233 | SYCE1 | 500 | 586 | 1.0 | 10.1 |
| TkAUNG083930 | PF08082 | PRO8NT | 723 | 748 | 2.2e-84 | 281.7 |
| TkAUNG083930 | PF10598 | RRM_4 | 1019 | 1109 | 5.8e-47 | 158.7 |
| TkAUNG083930 | PF10597 | U5_2-snRNA_bdg | 1271 | 1406 | 2.7e-75 | 251.6 |
| TkAUNG083930 | PF10596 | U6-snRNA_bdg | 1476 | 1634 | 2.6e-89 | 297.8 |
| TkAUNG083930 | PF15233 | SYCE1 | 1625 | 1653 | 1.0 | 10.1 |
| TkAUNG083930 | PF10596 | U6-snRNA_bdg | 1663 | 1688 | 2.6e-89 | 297.8 |
| TkAUNG083930 | PF12134 | PRP8_domainIV | 1794 | 2023 | 2.7e-129 | 430.3 |
| TkAUNG083930 | PF01398 | JAB | 2134 | 2232 | 2.9e-11 | 43.9 |
| TkAUNG083930 | PF08084 | PROCT | 2246 | 2366 | 5.3e-50 | 169.2 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.