TkAUNG081140 | RubberDandelionOmics

Gene overview

TkAUNG081140

Reference: TK1151 Chr: ChrUn Coordinates: 23120303-23123026 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2643 bp · TkAUNG081140|TK1151|cDNA

CTTGTCTTGGAACGAAAGTTAAACATTCAACGGCCATGACGCGTATTCTTTCTTTCTCTCTCCCTTGAATTTTCATTTCGTTCAAGCAGCAGTATCATCGTTGGTAGCACAAAATTCGATTGATAAACGTTCATCGTTGAATTTTGAACCCGTAAAATACTCACAGTTTACGGTCGGAATTCAATTTGCTCCAAATTGATCGGCTATATGGTCTCTGCATCGTAGTACGTTCTTTCGTTGATTCTTGCTTAATTGAGCTG...

CDS

Download CDS FASTA

1647 bp · TkAUNG081140|TK1151|CDS

ATGTCGTCCGCTGGTGTTGTTGCTCGTAGGCCAGTTTGTGACGACTCCGTTTTACCTTCGTTCTCTGTGCATAACCAAGATCCGATTATGATTCAATTGTCTATGTCTGGTTCCGTGGTTCCAATGAGGGTGCTGGAGTCAGAGTCCATTGAGTCCGTGAAACTTCGGATTCAAAGCTATAAGGGGTTTGTTGTGAAGAACCAGAAGTTGGTTTGTGGAGGTAGGGTATTATCCAGGAGTAATTCTTTGGTTAGGGAGTA...

Protein

Download Protein FASTA

548 aa · TkAUNG081140|TK1151|PROTEIN

MSSAGVVARRPVCDDSVLPSFSVHNQDPIMIQLSMSGSVVPMRVLESESIESVKLRIQSYKGFVVKNQKLVCGGRVLSRSNSLVREYGVGDGNVIHLVVRISDLQMINIRTSCGKDFTFHVEKNRDVGYLKRQLAKEKKGFTNIHEQEILCDGEQLEDEKLINDICKKNNDAVIHLFVRKSSKIRAKHIKKDCELTVTAPCSDDDVAVRPKEAVNRNIWLEPVIVNPKAALPCVLFDLANSTYEGLTNGNHPVRTSEGTG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG081140`
TK1151 ID	TkAUNG081140
OH-1004 ID	LXL04_022570
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.500
Protein coverage (%)	TK1151 99.270 / OH-1004 99.647 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG081140

Location ChrUn:23120303-23123026 (-)

Description Similar to PI4KG4: Phosphatidylinositol 4-kinase gamma 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g46500`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).	Characterization of a new family of protein kinases from Arabidopsis containing phosphoinositide 3/4-kinase and ubiquitin-like domains.2008 · DOI: 10.1042/bj20070959
`At5g24240`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`UniProt: Q9SGW8`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release
`At1g13640`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os02g0290500`	The phosphorylation of phosphatidylinositol (PI) to PI4P is the first committed step in the generation of phosphatidylinositol 4,5-bisphosphate (PIP2), a precursor of the second messenger inositol 1,4,5-trisphosphate (InsP3) (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_022570 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0034051 negative regulation of plant-type hypersensitive response Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0046854 phosphatidylinositol phosphate biosynthetic process Biological Process

GO:0048364 root development Biological Process

GO:0048579 negative regulation of long-day photoperiodism, flowering Biological Process

GO:0050821 protein stabilization Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:1902074 response to salt Biological Process

KEGG gene cross-reference

ath:AT2G03890

ath:AT2G46500

ath:AT5G24240

dosa:Os02g0290500

osa:4329058

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.448

Rank 1 · TkAUNG081140 · TK1151

Nucleus0.353

Rank 2 · TkAUNG081140 · TK1151

Cell membrane0.182

Rank 3 · TkAUNG081140 · TK1151

Endoplasmic reticulum0.100

Rank 4 · TkAUNG081140 · TK1151

Mitochondrion0.077

Rank 5 · TkAUNG081140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00240ubiquitin33-100 aa

PF11976Rad60-SLD36-99 aa

PF00240ubiquitin107-180 aa

PF11976Rad60-SLD107-171 aa

PF15044CLU_N135-176 aa

PF00454PI3_PI4_kinase259-496 aa

PF03109ABC1265-286 aa

PF03109ABC1385-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG081140	`PF00240`	ubiquitin	33	100	2.5e-23	82.3
TkAUNG081140	`PF11976`	Rad60-SLD	36	99	1.7e-06	28.5
TkAUNG081140	`PF00240`	ubiquitin	107	180	2.5e-23	82.3
TkAUNG081140	`PF11976`	Rad60-SLD	107	171	1.7e-06	28.5
TkAUNG081140	`PF15044`	CLU_N	135	176	0.27	12.4
TkAUNG081140	`PF00454`	PI3_PI4_kinase	259	496	3.7e-51	175.1
TkAUNG081140	`PF03109`	ABC1	265	286	0.012	15.5
TkAUNG081140	`PF03109`	ABC1	385	421	0.012	15.5
TkAUNG081140	`PF15044`	CLU_N	489	522	0.27	12.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9ZPY9`	Arabidopsis thaliana	sp\|Q9ZPY9\|P4KG4_ARATH Phosphatidylinositol 4-kinase gamma 4	60.000%	Swiss-Prot	High
`Q9FNF8`	Arabidopsis thaliana	sp\|Q9FNF8\|P4KG3_ARATH Phosphatidylinositol 4-kinase gamma 3	55.200%	Swiss-Prot	High
`Q9SGW8`	Arabidopsis thaliana	sp\|Q9SGW8\|P4KG2_ARATH Phosphatidylinositol 4-kinase gamma 2	55.000%	Swiss-Prot	High
`Q8W4R8`	Arabidopsis thaliana	sp\|Q8W4R8\|P4KG6_ARATH Phosphatidylinositol 4-kinase gamma 6	41.800%	Swiss-Prot	Low
`Q6K881`	Oryza sativa subsp. japonica	sp\|Q6K881\|P4KG4_ORYSJ Phosphatidylinositol 4-kinase gamma 4	53.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card