TkAUNG078750 | RubberDandelionOmics

Gene overview

TkAUNG078750

Reference: TK1151 Chr: ChrUn Coordinates: 22527452-22530925 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2695 bp · TkAUNG078750|TK1151|cDNA

AAAAAATCACAATAATATGAAACAGACATTGACAATAATACCCTTAGCAAGGTTCTATATAAAAGGGCCTTAGATGTGATTTATGTGCACATACATCAAACCACAAACCTAGACCAAAACCCCCAATTGTCTTTTACTCCTCCAACTAGAAGTCTATAAGTTCTCCAAAATTAGGGTTTGATTCACTTTCATTGAAAGGGGTGAGTGAGGTGATTGAACCCCAATCAATTCCTTGCTTCACAAATCTGAGTATCTGACTC...

CDS

Download CDS FASTA

1992 bp · TkAUNG078750|TK1151|CDS

ATGGCCTATAATTCCGAATTGAAATATGGGTCGGATTTGAACACTGTCGAGATTCCAGAATCTTGCAGAAACGATGAACTGTCTGTAAATCCCGATTTGTATGATAACGGATTGAGGGAATTGTTCGATCAAGTTCTTTCGTTCTTCTTAAAAGAAACATCTTTGAAAACAAATGCGATTAGGCCTTTTCCACCTAAACTCGGTGAAGGGGTAGAAGCCGATTTATTCAAACTGTTCTTGACTGTGAAAAGAATAGGAAG...

Protein

Download Protein FASTA

663 aa · TkAUNG078750|TK1151|PROTEIN

MAYNSELKYGSDLNTVEIPESCRNDELSVNPDLYDNGLRELFDQVLSFFLKETSLKTNAIRPFPPKLGEGVEADLFKLFLTVKRIGSYEIVSENNLWEFVAKECGFEIGVEGSLKLVYVKYLKELDQWLIEGGFKENLDTRVIEKLDLLSQQLDEYICFESNQIGKSLDEGTSGFNQNEGGMNLDVPFSIINGDDDDEKFRVGDDKRCELSSEIVKKVGVSMINDDVKRTELSPKNVVKNVALSVINIDDDDNDDEEFSI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG078750`
TK1151 ID	TkAUNG078750
OH-1004 ID	LXL04_005557
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	98.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG078750

Location ChrUn:22527452-22530925 (+)

Description Similar to ARID2: AT-rich interactive domain-containing protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g11400`	AT-rich interactive domain-containing protein 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005557 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0010628 positive regulation of gene expression Biological Process

GO:0048235 pollen sperm cell differentiation Biological Process

GO:0000118 histone deacetylase complex Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005773 vacuole Cellular Component

GO:0048555 generative cell nucleus Cellular Component

GO:0048556 microsporocyte nucleus Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT2G46040

ath:AT4G11400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.974

Rank 1 · TkAUNG078750 · TK1151

Cytoplasm0.074

Rank 2 · TkAUNG078750 · TK1151

Cell membrane0.021

Rank 3 · TkAUNG078750 · TK1151

Plastid0.010

Rank 4 · TkAUNG078750 · TK1151

Endoplasmic reticulum0.010

Rank 5 · TkAUNG078750 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01388ARID40-124 aa

PF31146MIT_ATG38118-157 aa

PF31146MIT_ATG38240-297 aa

PF01448ELM2450-482 aa

PF01448ELM2546-554 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG078750	`PF01388`	ARID	40	124	3e-09	37.9
TkAUNG078750	`PF31146`	MIT_ATG38	118	157	2.9	8.9
TkAUNG078750	`PF31146`	MIT_ATG38	240	297	2.9	8.9
TkAUNG078750	`PF01448`	ELM2	450	482	0.5	12.0
TkAUNG078750	`PF01448`	ELM2	546	554	0.5	12.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LDD4`	Arabidopsis thaliana	sp\|Q9LDD4\|ARID2_ARATH AT-rich interactive domain-containing protein 2	31.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card