TkAUNG077100 | RubberDandelionOmics

Gene overview

TkAUNG077100

Reference: TK1151 Chr: ChrUn Coordinates: 22140201-22141176 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

486 bp · TkAUNG077100|TK1151|cDNA

ATGATTATTGAGCTGGATTCATCTAAGAAGTTAGCAGAAATGGAGGGCTGGACTACCAGAGCTGATGGTGTAAGAACCCCCGCAATGGAGATTATCATGGATGAACTTACTTATGACAAAGATTTATTGTTCCCATTCTTTCAGGCATTGGATAAACAACCTAAACTAAAGCTGGATATGATTGTTCAGTATCTCCAAAAGTACATTCCCAAGACATCTGTACGCACTCGAAGGTCCAGTGATTCTACAAATATTTCAAC...

CDS

Download CDS FASTA

486 bp · TkAUNG077100|TK1151|CDS

ATGATTATTGAGCTGGATTCATCTAAGAAGTTAGCAGAAATGGAGGGCTGGACTACCAGAGCTGATGGTGTAAGAACCCCCGCAATGGAGATTATCATGGATGAACTTACTTATGACAAAGATTTATTGTTCCCATTCTTTCAGGCATTGGATAAACAACCTAAACTAAAGCTGGATATGATTGTTCAGTATCTCCAAAAGTACATTCCCAAGACATCTGTACGCACTCGAAGGTCCAGTGATTCTACAAATATTTCAAC...

Protein

Download Protein FASTA

161 aa · TkAUNG077100|TK1151|PROTEIN

MIIELDSSKKLAEMEGWTTRADGVRTPAMEIIMDELTYDKDLLFPFFQALDKQPKLKLDMIVQYLQKYIPKTSVRTRRSSDSTNISTFGGVLKSFSNGSNTKGIIKKMSTEVAQLLLAHAFQAYISLPYQDSSESKEDDNDDNSLPDICNHMISAFTCLKK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG077100`
TK1151 ID	TkAUNG077100
OH-1004 ID	LXL04_010294
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	91.300
Protein coverage (%)	TK1151 100.000 / OH-1004 33.753 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG077100

Location ChrUn:22140201-22141176 (+)

Description Similar to SNI1: Negative regulator of systemic acquired resistance SNI1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g18470`	Component of the SMC5-SMC6 complex, a complex involved in repair of DNA double-strand breaks by homologous recombination.	Identification and cloning of a negative regulator of systemic acquired resistance, SNI1, through a screen for suppressors of npr1-1.1999 · DOI: 10.1016/s0092-8674(00)81962-5 A comprehensive structure-function analysis of Arabidopsis SNI1 defines essential regions and transcriptional repressor activity.2006 · DOI: 10.1105/tpc.105.039677 Arabidopsis SNI1 and RAD51D regulate both gene transcription and DNA recombination during the defense response.2007 · DOI: 10.1073/pnas.0609357104 Genetic interactions of TGA transcription factors in the regulation of pathogenesis-related genes and disease resistance in Arabidopsis.2007 · DOI: 10.1104/pp.106.095299 Cyst nematode parasitism of Arabidopsis thaliana is inhibited by salicylic acid (SA) and elicits uncoupled SA-independent pathogenesis-related gene expression in roots.2008 · DOI: 10.1094/mpmi-21-4-0424 The Arabidopsis PR-1 promoter contains multiple integration sites for the coactivator NPR1 and the repressor SNI1.2010 · DOI: 10.1104/pp.110.165563 Arabidopsis BRCA2 and RAD51 proteins are specifically involved in defense gene transcription during plant immune responses.2010 · DOI: 10.1073/pnas.1005978107 DNA repair proteins are directly involved in regulation of gene expression during plant immune response.2011 · DOI: 10.1016/j.chom.2011.01.011 A NAC transcription factor and SNI1 cooperatively suppress basal pathogen resistance in Arabidopsis thaliana.2012 · DOI: 10.1093/nar/gks683

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_010294 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002215 defense response to nematode Biological Process

GO:0006281 DNA repair Biological Process

GO:0006338 chromatin remodeling Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006974 DNA damage response Biological Process

GO:0009626 plant-type hypersensitive response Biological Process

GO:0009627 systemic acquired resistance Biological Process

GO:0010113 negative regulation of systemic acquired resistance Biological Process

GO:0016444 somatic cell DNA recombination Biological Process

GO:0031348 negative regulation of defense response Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G18470

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.281

Rank 1 · TkAUNG077100 · TK1151

Nucleus0.256

Rank 2 · TkAUNG077100 · TK1151

Cytoplasm0.236

Rank 3 · TkAUNG077100 · TK1151

Endoplasmic reticulum0.144

Rank 4 · TkAUNG077100 · TK1151

Mitochondrion0.137

Rank 5 · TkAUNG077100 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28645SNI1_middle1-51 aa

PF26722TPR_INTS8_243-121 aa

PF28650SNI1_C69-161 aa

PF28645SNI1_middle102-122 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG077100	`PF28645`	SNI1_middle	1	51	1.1e-23	84.8
TkAUNG077100	`PF26722`	TPR_INTS8_2	43	121	0.16	12.4
TkAUNG077100	`PF28650`	SNI1_C	69	161	3.6e-37	127.5
TkAUNG077100	`PF28645`	SNI1_middle	102	122	1.1e-23	84.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SWA6`	Arabidopsis thaliana	sp\|Q9SWA6\|SNI1_ARATH Negative regulator of systemic acquired resistance SNI1	50.300%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card