TkAUNG075310 | RubberDandelionOmics

Gene overview

TkAUNG075310

Reference: TK1151 Chr: ChrUn Coordinates: 21706993-21707643 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

651 bp · TkAUNG075310|TK1151|cDNA

ATGACAACCAACCGCCGTTATAACTCTTCTTGCGCCGCCTGCCGCTTCTCCCGCCGCTGCTGTTCGCCGGACTGTCCACTTGCACCATATTTTCCGGCCAGTCAACCACAAGTCTTCCAGCATGTCCACCGCCTCTACGGCACCGGAAAGATCGTCAGGATACTAAATCTGTTAAAAGGCAATGATCGGAAACAAGAAGAAGCGATGCTATCGATCAAATACGAATCTTTCATCCGTCATATCAATCCAGTTGACGGCTG...

CDS

Download CDS FASTA

651 bp · TkAUNG075310|TK1151|CDS

ATGACAACCAACCGCCGTTATAACTCTTCTTGCGCCGCCTGCCGCTTCTCCCGCCGCTGCTGTTCGCCGGACTGTCCACTTGCACCATATTTTCCGGCCAGTCAACCACAAGTCTTCCAGCATGTCCACCGCCTCTACGGCACCGGAAAGATCGTCAGGATACTAAATCTGTTAAAAGGCAATGATCGGAAACAAGAAGAAGCGATGCTATCGATCAAATACGAATCTTTCATCCGTCATATCAATCCAGTTGACGGCTG...

Protein

Download Protein FASTA

216 aa · TkAUNG075310|TK1151|PROTEIN

MTTNRRYNSSCAACRFSRRCCSPDCPLAPYFPASQPQVFQHVHRLYGTGKIVRILNLLKGNDRKQEEAMLSIKYESFIRHINPVDGCYGAISYLKQKLVHLMSELQCVRSLLDSCRRNNRKIIQDSVIASSPESRSIYNDQSVGGLSNSAAIDQTIDENYPGFNLVGLCDRDRNANEALKTMEPPLDIDNWADKEITNDDLMRILYDSDEGSCGKH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG075310`
TK1151 ID	TkAUNG075310
OH-1004 ID	LXL04_006221
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG075310

Location ChrUn:21706993-21707643 (+)

Description Similar to LBD27: LOB domain-containing protein 27

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47870`	LOB domain-containing protein 27.	No verified direct reference in this release
`At1g65620`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2WXT0`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release
`Os01g0889400`	Negative regulator of cell proliferation in the adaxial side of leaves.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006221 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009555 pollen development Biological Process

GO:0009556 microsporogenesis Biological Process

GO:0009786 regulation of asymmetric cell division Biological Process

GO:0009799 specification of symmetry Biological Process

GO:0009943 adaxial/abaxial axis specification Biological Process

GO:0009944 polarity specification of adaxial/abaxial axis Biological Process

GO:0009954 proximal/distal pattern formation Biological Process

GO:0010199 organ boundary specification between lateral organs and the meristem Biological Process

GO:0048441 petal development Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

KEGG gene cross-reference

ath:AT1G65620

ath:AT3G27650

ath:AT3G47870

ath:AT5G63090

zma:732739

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkAUNG075310 · TK1151

Cytoplasm0.098

Rank 2 · TkAUNG075310 · TK1151

Cell membrane0.023

Rank 3 · TkAUNG075310 · TK1151

Endoplasmic reticulum0.013

Rank 4 · TkAUNG075310 · TK1151

Plastid0.011

Rank 5 · TkAUNG075310 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03195LOB10-109 aa

PF02383Syja_N39-83 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG075310	`PF03195`	LOB	10	109	2e-28	99.6
TkAUNG075310	`PF02383`	Syja_N	39	83	0.065	13.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STS6`	Arabidopsis thaliana	sp\|Q9STS6\|LBD27_ARATH LOB domain-containing protein 27	44.800%	Swiss-Prot	Medium
`O04479`	Arabidopsis thaliana	sp\|O04479\|AS2_ARATH Protein ASYMMETRIC LEAVES 2	45.700%	Swiss-Prot	Low
`A2WXT0`	Oryza sativa subsp. indica	sp\|A2WXT0\|LBD6_ORYSI LOB domain-containing protein 6	46.400%	Swiss-Prot	Low
`Q8LQH4`	Oryza sativa subsp. japonica	sp\|Q8LQH4\|LBD6_ORYSJ LOB domain-containing protein 6	46.400%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card