TkAUNG071530 | RubberDandelionOmics

Gene overview

TkAUNG071530

Reference: TK1151 Chr: ChrUn Coordinates: 20700874-20703828 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1878 bp · TkAUNG071530|TK1151|cDNA

ATGGAGGAAGTGGTATCGGTGTTCCAGAGCAATCCAGGAAAATACTCAATGCACACAACAAGATCATGGGAATTTGCAGGTTTGCAAGTGGGAATGAAATGGAAGAATTCAGAGAGGGAAAGTTTATTGCTCAAATCCAGATATGGGAAAGATGTTATTGTTGGCATATTAGACAATGGTGTTTGGCCAGAGTCAAAAAGCTTTAACGATAGGGGGATGGGTCCTATACCAAAATCATGGAAAGGAATTTGTCAATCTGG...

CDS

Download CDS FASTA

1878 bp · TkAUNG071530|TK1151|CDS

ATGGAGGAAGTGGTATCGGTGTTCCAGAGCAATCCAGGAAAATACTCAATGCACACAACAAGATCATGGGAATTTGCAGGTTTGCAAGTGGGAATGAAATGGAAGAATTCAGAGAGGGAAAGTTTATTGCTCAAATCCAGATATGGGAAAGATGTTATTGTTGGCATATTAGACAATGGTGTTTGGCCAGAGTCAAAAAGCTTTAACGATAGGGGGATGGGTCCTATACCAAAATCATGGAAAGGAATTTGTCAATCTGG...

Protein

Download Protein FASTA

625 aa · TkAUNG071530|TK1151|PROTEIN

MEEVVSVFQSNPGKYSMHTTRSWEFAGLQVGMKWKNSERESLLLKSRYGKDVIVGILDNGVWPESKSFNDRGMGPIPKSWKGICQSGDQFNSSHCNKKIVGARYYVKGYEAYYGQLNRTLDLLSPRDMDGHGTHTASTLGGRRVKHVSALGGFARGTASGGAPLARLAIYKVCWAIPGKGKENGNTCFEEDMLAAIDDAIADGVNVLSISIGTSVPTPFKQDGIAIGALHAIKKNIIVACSAGNSGPAPSTLSNPAPWII...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG071530`
TK1151 ID	TkAUNG071530
OH-1004 ID	LXL04_001765
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	49.800
Protein coverage (%)	TK1151 96.800 / OH-1004 77.003 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG071530

Location ChrUn:20700874-20703828 (-)

Description Similar to AIR3: Subtilisin-like protease SBT5.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g45650`	Subtilisin-like protease SBT5.6.	No verified direct reference in this release
`At5g45640`	Subtilisin-like protease SBT5.5.	No verified direct reference in this release
`At2g04160`	Serine protease.	No verified direct reference in this release
`At5g59810`	Serine protease.	Overexpression of an Arabidopsis gene encoding a subtilase (AtSBT5.4) produces a clavata-like phenotype.2009 · DOI: 10.1007/s00425-009-0976-5
`At5g67360`	Serine protease.	Ara12 subtilisin-like protease from Arabidopsis thaliana: purification, substrate specificity and tissue localization.2003 · DOI: 10.1042/bj20021125 A subtilisin-like serine protease essential for mucilage release from Arabidopsis seed coats.2008 · DOI: 10.1111/j.1365-313x.2008.03437.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_001765 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0009609 response to symbiotic bacterium Biological Process

GO:0009610 response to symbiotic fungus Biological Process

GO:0009733 response to auxin Biological Process

GO:0009827 plant-type cell wall modification Biological Process

GO:0010074 maintenance of meristem identity Biological Process

GO:0010102 lateral root morphogenesis Biological Process

GO:0010214 seed coat development Biological Process

GO:0080001 mucilage extrusion from seed coat Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G04160

ath:AT4G34980

ath:AT5G59810

ath:AT5G67360

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Extracellular0.741

Rank 1 · TkAUNG071530 · TK1151

Lysosome / Vacuole0.097

Rank 2 · TkAUNG071530 · TK1151

Cell membrane0.067

Rank 3 · TkAUNG071530 · TK1151

Cytoplasm0.057

Rank 4 · TkAUNG071530 · TK1151

Endoplasmic reticulum0.040

Rank 5 · TkAUNG071530 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00082Peptidase_S849-535 aa

PF02225PA298-391 aa

PF17766fn3_6583-618 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG071530	`PF00082`	Peptidase_S8	49	535	3.8e-42	145.3
TkAUNG071530	`PF02225`	PA	298	391	1.6e-10	41.7
TkAUNG071530	`PF17766`	fn3_6	583	618	1.4e-06	29.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9FK76`	Arabidopsis thaliana	sp\|Q9FK76\|SBT56_ARATH Subtilisin-like protease SBT5.6	61.800%	Swiss-Prot	High
`F4KEL0`	Arabidopsis thaliana	sp\|F4KEL0\|SBT55_ARATH Subtilisin-like protease SBT5.5	59.000%	Swiss-Prot	High
`Q9ZSP5`	Arabidopsis thaliana	sp\|Q9ZSP5\|AIR3_ARATH Subtilisin-like protease SBT5.3	49.700%	Swiss-Prot	Medium
`F4JXC5`	Arabidopsis thaliana	sp\|F4JXC5\|SBT54_ARATH Subtilisin-like protease SBT5.4	48.800%	Swiss-Prot	Medium
`O65351`	Arabidopsis thaliana	sp\|O65351\|SBT17_ARATH Subtilisin-like protease SBT1.7	48.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card