TkAUNG070940 | RubberDandelionOmics

Gene overview

TkAUNG070940

Reference: TK1151 Chr: ChrUn Coordinates: 20549509-20555978 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

621 bp · TkAUNG070940|TK1151|cDNA

ATGATTATGTGCAGGTTCAAACGAGCTAGGGTTATCAAAATGTACATAAAGCAGGTCATCATTGAAGGGTTTAAGAGCTACAAAGAACAAGTTGCAACTGATGATTTCAGTCCAAAAGTCAACTGTGTTGTTGGTGCAAATGGATCTGGCAAGTCGAATTTCTTTTCAGCAATTCGGTTTGTAATAAGCGACCTCTTTCATAACTTGAGGAATGAAGATAAACACGCCTTTCTCCATGAAGGAGCAGGACACCAAGTTCT...

CDS

Download CDS FASTA

621 bp · TkAUNG070940|TK1151|CDS

ATGATTATGTGCAGGTTCAAACGAGCTAGGGTTATCAAAATGTACATAAAGCAGGTCATCATTGAAGGGTTTAAGAGCTACAAAGAACAAGTTGCAACTGATGATTTCAGTCCAAAAGTCAACTGTGTTGTTGGTGCAAATGGATCTGGCAAGTCGAATTTCTTTTCAGCAATTCGGTTTGTAATAAGCGACCTCTTTCATAACTTGAGGAATGAAGATAAACACGCCTTTCTCCATGAAGGAGCAGGACACCAAGTTCT...

Protein

Download Protein FASTA

206 aa · TkAUNG070940|TK1151|PROTEIN

MIMCRFKRARVIKMYIKQVIIEGFKSYKEQVATDDFSPKVNCVVGANGSGKSNFFSAIRFVISDLFHNLRNEDKHAFLHEGAGHQVLSAFVGIVFDNSDNRIPVDKEEVHLRRTIGTKKDEFILDGKHITKTEVMNLLESAGFSRSNPYYVVQQGKIASLTLMKDAERLDLLKEIGGTRVYEERHRESLKIMQETGKSLILTLTYC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG070940`
TK1151 ID	TkAUNG070940
OH-1004 ID	LXL04_014802
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	96.500
Protein coverage (%)	TK1151 97.573 / OH-1004 16.422 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG070940

Location ChrUn:20549509-20555978 (-)

Description Similar to SMC3: Structural maintenance of chromosomes protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g27170`	Central component of cohesin, a complex required for chromosome cohesion during the cell cycle.	Condensin and cohesin knockouts in Arabidopsis exhibit a titan seed phenotype.2002 · DOI: 10.1046/j.1365-313x.2002.01224.x Cohesin gene defects may impair sister chromatid alignment and genome stability in Arabidopsis thaliana.2009 · DOI: 10.1007/s00412-009-0220-x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014802 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000278 mitotic cell cycle Biological Process

GO:0006275 regulation of DNA replication Biological Process

GO:0006281 DNA repair Biological Process

GO:0007059 chromosome segregation Biological Process

GO:0007062 sister chromatid cohesion Biological Process

GO:0007064 mitotic sister chromatid cohesion Biological Process

GO:0019827 stem cell population maintenance Biological Process

GO:0051301 cell division Biological Process

GO:0051321 meiotic cell cycle Biological Process

GO:0090307 mitotic spindle assembly Biological Process

GO:0000775 chromosome, centromeric region Cellular Component

GO:0000785 chromatin Cellular Component

KEGG gene cross-reference

ani:ANIA_06364

ath:AT2G27170

bta:281729

mmu:13006

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.573

Rank 1 · TkAUNG070940 · TK1151

Cytoplasm0.414

Rank 2 · TkAUNG070940 · TK1151

Cell membrane0.063

Rank 3 · TkAUNG070940 · TK1151

Mitochondrion0.061

Rank 4 · TkAUNG070940 · TK1151

Endoplasmic reticulum0.053

Rank 5 · TkAUNG070940 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13175AAA_1514-123 aa

PF02463SMC_N15-145 aa

PF13476AAA_2319-186 aa

PF19557BrxC-PglY_N34-72 aa

PF13514AAA_2735-134 aa

PF13555AAA_2936-62 aa

PF13304AAA_2140-69 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG070940	`PF13175`	AAA_15	14	123	2e-12	48.1
TkAUNG070940	`PF02463`	SMC_N	15	145	2.2e-33	116.3
TkAUNG070940	`PF13476`	AAA_23	19	186	1.1e-14	56.2
TkAUNG070940	`PF19557`	BrxC-PglY_N	34	72	0.12	12.4
TkAUNG070940	`PF13514`	AAA_27	35	134	0.00071	19.9
TkAUNG070940	`PF13555`	AAA_29	36	62	0.029	14.8
TkAUNG070940	`PF13304`	AAA_21	40	69	4.7e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q56YN8`	Arabidopsis thaliana	sp\|Q56YN8\|SMC3_ARATH Structural maintenance of chromosomes protein 3	85.200%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card