TkAUNG070740 | RubberDandelionOmics

Gene overview

TkAUNG070740

Reference: TK1151 Chr: ChrUn Coordinates: 20508131-20514530 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

901 bp · TkAUNG070740|TK1151|cDNA

ATAAAACATTAGTAAAGTATTTCGCAAAAGAAAAAAAAAAAACACGGCGCTAGTTAGACTGAAATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTC...

CDS

Download CDS FASTA

1305 bp · TkAUNG070740|TK1151|CDS

ATGGATTTGAAGGTGAAGGTAGGAGGTGTAAAAGATGGGGATATGTCAGAACCGGTGAGCCCTACCGGGCAGTACTTCAACAGCTCGGTGCTTTCTGTTTCTCTTATTTGCATTTTGGAGTTTGACAACCCCATTGATGACTCTTCAAGCCTTTCACTAATCAACGATGTCTTTCTGCCCATTAGTGCTCGTTTCTCTTCCATTATGGTTAAAGACAAAGATGGAGTGAAGCGCTGGAAGAGAGTAGAAGTAAACGGGAA...

Protein

Download Protein FASTA

434 aa · TkAUNG070740|TK1151|PROTEIN

MDLKVKVGGVKDGDMSEPVSPTGQYFNSSVLSVSLICILEFDNPIDDSSSLSLINDVFLPISARFSSIMVKDKDGVKRWKRVEVNGKDHIKVPCFPEGLSPESYDHYFNDYLSNIAMDPLPQTKPLWEIHVIKYPTTNASGNLVFKLHHALGDGYSLMGALLSCLQRADNPSLPLTFPHFQKHVTPENKVKSLIGVVPQVLSGALNSVMDFGWSVLQSSFLKDRESPICSGKEGVEFRPINIMTMKFSLDEIKRIKSCLQ...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG070740`
TK1151 ID	TkAUNG070740
OH-1004 ID	LXL04_019922
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	69.900
Protein coverage (%)	TK1151 98.618 / OH-1004 99.789 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG070740

Location ChrUn:20508131-20514530 (+)

Description Similar to WSD1: O-acyltransferase WSD1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g72110`	Bifunctional wax ester synthase/diacylglycerol acyltransferase (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_019922 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0019432 triglyceride biosynthetic process Biological Process

GO:0048441 petal development Biological Process

GO:0048446 petal morphogenesis Biological Process

GO:0000139 Golgi membrane Cellular Component

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

GO:0005794 Golgi apparatus Cellular Component

KEGG gene cross-reference

ath:AT3G49190

ath:AT3G49200

ath:AT3G49210

ath:AT5G12420

ath:AT5G53390

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.476

Rank 1 · TkAUNG070740 · TK1151

Cytoplasm0.164

Rank 2 · TkAUNG070740 · TK1151

Nucleus0.156

Rank 3 · TkAUNG070740 · TK1151

Lysosome / Vacuole0.141

Rank 4 · TkAUNG070740 · TK1151

Cell membrane0.134

Rank 5 · TkAUNG070740 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07247AATase102-156 aa

PF03007WS_DGAT_cat108-267 aa

PF06974WS_DGAT_C321-381 aa

PF07247AATase350-398 aa

PF06974WS_DGAT_C380-421 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG070740	`PF07247`	AATase	102	156	0.038	13.3
TkAUNG070740	`PF03007`	WS_DGAT_cat	108	267	1.3e-12	48.8
TkAUNG070740	`PF06974`	WS_DGAT_C	321	381	1.4e-14	55.1
TkAUNG070740	`PF07247`	AATase	350	398	0.038	13.3
TkAUNG070740	`PF06974`	WS_DGAT_C	380	421	1.4e-14	55.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C7H4`	Arabidopsis thaliana	sp\|Q9C7H4\|WSD2_ARATH Wax ester synthase/diacylglycerol acyltransferase 2	28.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card