RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkAUNG064030
Reference: TK1151 Chr: ChrUn Coordinates: 18517817-18527054 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3621 bp · TkAUNG064030|TK1151|cDNA

ATGGACATTGTTGGAATAAGTCAGAAAGAGCAGGATGCAATTTTCAGAGTAGTGGCAGCTATTCTTCATCTTGGTAATGTTGAATTTGCTAAAGGAAAGGAAATTGATTCATCAGTCCTGAAGGATGACACATCGAAGTTCCATCTTAAGACTGTCGCAGAGCTTCTGATGTGTGATCTTACTGCACTCGAAGATGCATTACTGAAGCGTGTGATGGTAACTCCAGAAGAAGTTATTAAGAGAAGTCTTGATCCTGATGG...

CDS

Download CDS FASTA

3621 bp · TkAUNG064030|TK1151|CDS

ATGGACATTGTTGGAATAAGTCAGAAAGAGCAGGATGCAATTTTCAGAGTAGTGGCAGCTATTCTTCATCTTGGTAATGTTGAATTTGCTAAAGGAAAGGAAATTGATTCATCAGTCCTGAAGGATGACACATCGAAGTTCCATCTTAAGACTGTCGCAGAGCTTCTGATGTGTGATCTTACTGCACTCGAAGATGCATTACTGAAGCGTGTGATGGTAACTCCAGAAGAAGTTATTAAGAGAAGTCTTGATCCTGATGG...

Protein

Download Protein FASTA

1206 aa · TkAUNG064030|TK1151|PROTEIN

MDIVGISQKEQDAIFRVVAAILHLGNVEFAKGKEIDSSVLKDDTSKFHLKTVAELLMCDLTALEDALLKRVMVTPEEVIKRSLDPDGALVSRDGLAKTVYSRLFDWLVDKINNSIGQDPNSKCLIGVLDIYGFESFKTNSFEQFCINFTNEKLQQHFNQHVFKMEQEEYTKEEIDWSYIEFVDNQDVLDLIEKKPGGIVALLDEACMFPKSTHETFSQKLYQTFKSHKRFIKPKLSRTDFTISHYAGEVQYQSDQFLDKN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkAUNG064030
TK1151 IDTkAUNG064030
OH-1004 IDLXL04_018761
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)78.700
Protein coverage (%)TK1151 99.917 / OH-1004 79.882
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkAUNG064030
LocationChrUn:18517817-18527054 (+)
DescriptionSimilar to XI-E: Myosin-11
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At1g08730 Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation. No verified direct reference in this release
At1g54560 Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation. No verified direct reference in this release
At5g20490 Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation. No verified direct reference in this release
At1g17580 Myosin heavy chain that is required for the cell cycle- regulated transport of various organelles and proteins for their segregation.
Enzymatic activity and motility of recombinant Arabidopsis myosin XI, MYA1.2007 · DOI: 10.1093/pcp/pcm054
A comparative study of the involvement of 17 Arabidopsis myosin family members on the motility of Golgi and other organelles.2009 · DOI: 10.1104/pp.109.136853
Myosin XIK is a major player in cytoplasm dynamics and is regulated by two amino acids in its tail.2012 · DOI: 10.1093/jxb/err265
At1g04160 Myosin heavy chain that is required for the cell cycle-regulated transport of various organelles and proteins for their segregation. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_018761 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0007015 actin filament organization Biological Process
GO:0009791 post-embryonic development Biological Process
GO:0009826 unidimensional cell growth Biological Process
GO:0009860 pollen tube growth Biological Process
GO:0010090 trichome morphogenesis Biological Process
GO:0010091 trichome branching Biological Process
GO:0010154 fruit development Biological Process
GO:0030048 actin filament-based movement Biological Process
GO:0048467 gynoecium development Biological Process
GO:0048767 root hair elongation Biological Process
GO:0048768 root hair cell tip growth Biological Process
GO:0051301 cell division Biological Process
KEGG gene cross-reference
ath:AT1G08730
ath:AT1G17580
ath:AT1G54560
ath:AT2G31900
ath:AT5G20490
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.566
Rank 1 · TkAUNG064030 · TK1151
Cell membrane0.274
Rank 2 · TkAUNG064030 · TK1151
Golgi apparatus0.195
Rank 3 · TkAUNG064030 · TK1151
Nucleus0.150
Rank 4 · TkAUNG064030 · TK1151
Lysosome / Vacuole0.074
Rank 5 · TkAUNG064030 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00063Myosin_head1-420 aa
PF16982Flp1_like308-318 aa
PF00612IQ438-455 aa
PF00612IQ460-474 aa
PF00612IQ485-503 aa
PF00612IQ510-527 aa
PF00612IQ532-546 aa
PF00612IQ556-575 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkAUNG064030PF00063Myosin_head14205e-146488.4
TkAUNG064030PF16982Flp1_like3083180.3311.2
TkAUNG064030PF00612IQ4384555.5e-1760.6
TkAUNG064030PF00612IQ4604745.5e-1760.6
TkAUNG064030PF00612IQ4855035.5e-1760.6
TkAUNG064030PF00612IQ5105275.5e-1760.6
TkAUNG064030PF00612IQ5325465.5e-1760.6
TkAUNG064030PF00612IQ5565755.5e-1760.6
TkAUNG064030PF01843DIL5666262.2e-30105.6
TkAUNG064030PF00261Tropomyosin5877733.17.9
TkAUNG064030PF11336DUF31386176971.28.5
TkAUNG064030PF01843DIL7197562.2e-30105.6
TkAUNG064030PF00063Myosin_head7487725e-146488.4
TkAUNG064030PF11336DUF31388348851.28.5
TkAUNG064030PF16982Flp1_like9339540.3311.2
TkAUNG064030PF01843DIL102411282.2e-30105.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
F4HXP9Arabidopsis thalianasp|F4HXP9|MYO9_ARATH Myosin-977.200%Swiss-ProtHigh
F4HWY6Arabidopsis thalianasp|F4HWY6|MYO11_ARATH Myosin-1177.600%Swiss-ProtHigh
F4K5J1Arabidopsis thalianasp|F4K5J1|MYO17_ARATH Myosin-1769.000%Swiss-ProtHigh
Q39160Arabidopsis thalianasp|Q39160|MYO5_ARATH Myosin-564.400%Swiss-ProtHigh
F4I460Arabidopsis thalianasp|F4I460|MYO8_ARATH Myosin-861.800%Swiss-ProtHigh

JBrowse

View in Genome Browser