TkAUNG056500 | RubberDandelionOmics

Gene overview

TkAUNG056500

Reference: TK1151 Chr: ChrUn Coordinates: 16092425-16095595 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1345 bp · TkAUNG056500|TK1151|cDNA

TATTACCTCACCGACTCTCACCCACCCACCCCACTCCCCTCACCTCTCTCTCTCTTTCTCCATTTATACACCTTCAAATCAGTCCTTCTCACTACTCTCTCTTTCTTTCTCTCTGTCTCTCTCTCATTTATGGACTATTTAGTGTTTTTTTCACTCGTTTTCATACTCAATGGACCATCGGTGACGAATGCTGGCTACTGGCCACCTTCACCTGGTTTCTACCCAAGTTCCAAGTTCAGGTCCATGACCTTTAACCAAGG...

CDS

Download CDS FASTA

582 bp · TkAUNG056500|TK1151|CDS

TATTACCTCACCGACTCTCACCCACCCACCCCACTCCCCTCACCTCTCTCTCTCTTTCTCCATTTATACACCTTCAAATCAGTCCTTCTCACTACTCTCTCTTTCTTTCTCTCTGTCTCTCTCTCATTTATGGACTATTTAGTGTTTTTTTCACTCGTTTTCATACTCAATGGACCATCGGTGACGAATGCTGGCTACTGGCCACCTTCACCTGGTTTCTACCCAAGTTCCAAGTTCAGGTCCATGACCTTTAACCAAGG...

Protein

Download Protein FASTA

193 aa · TkAUNG056500|TK1151|PROTEIN

YYLTDSHPPTPLPSPLSLFLHLYTFKSVLLTTLSFFLSVSLSFMDYLVFFSLVFILNGPSVTNAGYWPPSPGFYPSSKFRSMTFNQGFRNLWGPSHQSVHNNALDIWLDRTSGSGFKSVKPFRSGYFGASIKLQPGYTAGVITAFYLSNNEAHPGFHDEVDIEFLGTTFGKPYTLQTNVYIREVEMERLLAEK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG056500`
TK1151 ID	TkAUNG056500
OH-1004 ID	LXL04_005128
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 72.021 / OH-1004 46.801 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG056500

Location ChrUn:16092425-16095595 (-)

Description Similar to XTH32: Probable xyloglucan endotransglucosylase/hydrolase protein 32

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g36870`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	No verified direct reference in this release
`At3g44990`	Catalyzes xyloglucan endohydrolysis (XEH) and/or endotransglycosylation (XET).	Group III-A XTH genes of Arabidopsis encode predominant xyloglucan endohydrolases that are dispensable for normal growth.2013 · DOI: 10.1104/pp.112.207308 XTH31, encoding an in vitro XEH/XET-active enzyme, regulates aluminum sensitivity by modulating in vivo XET action, cell wall xyloglucan content, and aluminum binding capacity in Arabidopsis.2012 · DOI: 10.1105/tpc.112.106039 Distinct catalytic capacities of two aluminium-repressed Arabidopsis thaliana xyloglucan endotransglucosylase/hydrolases, XTH15 and XTH31, heterologously produced in Pichia.2015 · DOI: 10.1016/j.phytochem.2014.09.020

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005128 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009408 response to heat Biological Process

GO:0009831 plant-type cell wall modification involved in multidimensional cell growth Biological Process

GO:0010154 fruit development Biological Process

GO:0010411 xyloglucan metabolic process Biological Process

GO:0016998 cell wall macromolecule catabolic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0071555 cell wall organization Biological Process

GO:0080086 stamen filament development Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0048046 apoplast Cellular Component

KEGG gene cross-reference

ath:AT1G10550

ath:AT1G14720

ath:AT1G32170

ath:AT2G36870

ath:AT3G44990

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Lysosome / Vacuole0.288

Rank 1 · TkAUNG056500 · TK1151

Extracellular0.237

Rank 2 · TkAUNG056500 · TK1151

Endoplasmic reticulum0.235

Rank 3 · TkAUNG056500 · TK1151

Cytoplasm0.163

Rank 4 · TkAUNG056500 · TK1151

Golgi apparatus0.098

Rank 5 · TkAUNG056500 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00722Glyco_hydro_1685-182 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG056500	`PF00722`	Glyco_hydro_16	85	182	2.7e-22	79.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SJL9`	Arabidopsis thaliana	sp\|Q9SJL9\|XTH32_ARATH Probable xyloglucan endotransglucosylase/hydrolase protein 32	81.300%	Swiss-Prot	Medium
`P93046`	Arabidopsis thaliana	sp\|P93046\|XTH31_ARATH Xyloglucan endotransglucosylase/hydrolase protein 31	65.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card