TkAUNG048300 | RubberDandelionOmics

Gene overview

TkAUNG048300

Reference: TK1151 Chr: ChrUn Coordinates: 13385862-13393127 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

933 bp · TkAUNG048300|TK1151|cDNA

CATGTCTCCTACAATCTCAAAATATCATTATTTTTAGGCTACTTTTTTATATTTTATGTTCAATACCCACTTAATTTGGACGCCTTAGAGAGACTAGTAGCAAGATCACCATTGTTAAAGAAGCTTAGATTGAACCGTTACGTTTCGATAGGGCAGCTATACCGGTTAATTCTCCGGGTACCGCAGTTAACTCATTTGGGCACCGGTTCATTTAGTCCATTGGATATCAACGATCAACAACAAGAGCCCGATTACAGTTC...

CDS

Download CDS FASTA

1026 bp · TkAUNG048300|TK1151|CDS

CATGTCTCCTACAATCTCAAAATATCATTATTTTTAGGCTACTTTTTTATATTTTATGTTCAATACCCACTTAATTTGGACGCCTTAGAGAGACTAGTAGCAAGATCACCATTGTTAAAGAAGCTTAGATTGAACCGTTACGTTTCGATAGGGCAGCTATACCGGTTAATTCTCCGGGTACCGCAGTTAACTCATTTGGGCACCGGTTCATTTAGTCCATTGGATATCAACGATCAACAACAAGAGCCCGATTACAGTTC...

Protein

Download Protein FASTA

341 aa · TkAUNG048300|TK1151|PROTEIN

HVSYNLKISLFLGYFFIFYVQYPLNLDALERLVARSPLLKKLRLNRYVSIGQLYRLILRVPQLTHLGTGSFSPLDINDQQQEPDYSSAFAACRSIVCLSGFREISPEHLPAIYPVCANLTSLNLSYANIEPHQLRPAIRYCHKLQVFWDSSLRVRFFFSSIITQLLLQSLLIIDLVYSPKKKESWLLKKRGSKRMLLAVLIANSEGNILVERFNGVPGEERLHWRSFLVKLGADNLKGVKNEELLVACHKSVYIVYTVLG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG048300`
TK1151 ID	TkAUNG048300
OH-1004 ID	LXL04_018894
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	87.400
Protein coverage (%)	TK1151 51.320 / OH-1004 95.288 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG048300

Location ChrUn:13385862-13393127 (+)

Description Similar to tstD: TSET complex member tstD

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g49980`	Transport inhibitor response 1-like protein.	No verified direct reference in this release
`At4g24390`	F-box protein FBX14.	No verified direct reference in this release
`At3g26810`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	A plant miRNA contributes to antibacterial resistance by repressing auxin signaling.2006 · DOI: 10.1126/science.1126088
`At1g12820`	Confers sensitivity to the virulent bacterial pathogen P.syringae (By similarity).	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os04g0395600`	Transport inhibitor response 1-like protein Os04g0395600.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018894 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006886 intracellular protein transport Biological Process

GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum Biological Process

GO:0006891 intra-Golgi vesicle-mediated transport Biological Process

GO:0060098 membrane reorganization involved in phagocytosis, engulfment Biological Process

GO:0005886 plasma membrane Cellular Component

GO:0030126 COPI vesicle coat Cellular Component

KEGG gene cross-reference No functional description available

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.382

Rank 1 · TkAUNG048300 · TK1151

Cytoplasm0.321

Rank 2 · TkAUNG048300 · TK1151

Endoplasmic reticulum0.167

Rank 3 · TkAUNG048300 · TK1151

Golgi apparatus0.117

Rank 4 · TkAUNG048300 · TK1151

Cell membrane0.113

Rank 5 · TkAUNG048300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF24758LRR_At5g5637027-69 aa

PF24758LRR_At5g5637081-147 aa

PF01217Clat_adaptor_s195-331 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG048300	`PF24758`	LRR_At5g56370	27	69	0.0024	18.3
TkAUNG048300	`PF24758`	LRR_At5g56370	81	147	0.0024	18.3
TkAUNG048300	`PF01217`	Clat_adaptor_s	195	331	0.02	15.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LTX2`	Arabidopsis thaliana	sp\|Q9LTX2\|TIR1L_ARATH Transport inhibitor response 1-like protein	67.200%	Swiss-Prot	Low
`Q8RWQ8`	Arabidopsis thaliana	sp\|Q8RWQ8\|FBX14_ARATH F-box protein FBX14	64.100%	Swiss-Prot	Low
`Q9LW29`	Arabidopsis thaliana	sp\|Q9LW29\|AFB2_ARATH Protein AUXIN SIGNALING F-BOX 2	49.200%	Swiss-Prot	Low
`Q9LPW7`	Arabidopsis thaliana	sp\|Q9LPW7\|AFB3_ARATH Protein AUXIN SIGNALING F-BOX 3	47.400%	Swiss-Prot	Low
`Q7XVM8`	Oryza sativa subsp. japonica	sp\|Q7XVM8\|TIR1B_ORYSJ Transport inhibitor response 1-like protein Os04g0395600	46.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card