TkAUNG047480 | RubberDandelionOmics

Gene overview

TkAUNG047480

Reference: TK1151 Chr: ChrUn Coordinates: 13174622-13181890 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1686 bp · TkAUNG047480|TK1151|cDNA

AACTCAGATGTGCGTTGTGTTCAAGGCTTGCATTTATGGCGCAATAGTTCTTTACAGATTAACGATGAACTATACAAAGGTTATCGTAAAGGGAACTCAGAGAGAAAGATTAACGAGATTATAGCAGCTTATGATTTTATGAATTCAAATGAGAATCTATTCAATGTTACGATATGGTATAATTCTACATACAAGAATGACACAGGCAATCAGCCTCTTGCCTTAACACGGGTGCCTCGTTCAGTAAATTGGGCATCAAA...

CDS

Download CDS FASTA

1686 bp · TkAUNG047480|TK1151|CDS

AACTCAGATGTGCGTTGTGTTCAAGGCTTGCATTTATGGCGCAATAGTTCTTTACAGATTAACGATGAACTATACAAAGGTTATCGTAAAGGGAACTCAGAGAGAAAGATTAACGAGATTATAGCAGCTTATGATTTTATGAATTCAAATGAGAATCTATTCAATGTTACGATATGGTATAATTCTACATACAAGAATGACACAGGCAATCAGCCTCTTGCCTTAACACGGGTGCCTCGTTCAGTAAATTGGGCATCAAA...

Protein

Download Protein FASTA

562 aa · TkAUNG047480|TK1151|PROTEIN

NSDVRCVQGLHLWRNSSLQINDELYKGYRKGNSERKINEIIAAYDFMNSNENLFNVTIWYNSTYKNDTGNQPLALTRVPRSVNWASNAYLQLLLGQATKILFEFVKEMPKPATKLRLDFSSLLGPLFFTWVIVQLFPVILTSLVYEKEHRLRIMMKMHGLGDGPYWLISYAYFLALSSIYMICFVIFGSVIGLKFFTLNDYSIQFVFYFLYINLQVSLAFLVADLFSNVKTATVVGYLMVFGTGLLGGFLFQFFLQDSSF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkAUNG047480`
TK1151 ID	TkAUNG047480
OH-1004 ID	LXL04_031362
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	75.900
Protein coverage (%)	TK1151 99.644 / OH-1004 58.879 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkAUNG047480

Location ChrUn:13174622-13181890 (+)

Description Similar to ABCA7: ABC transporter A family member 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g47780`	ABC transporter A family member 7.	No verified direct reference in this release
`At3g47790`	ABC transporter A family member 8.	No verified direct reference in this release
`At3g47740`	ABC transporter A family member 3.	No verified direct reference in this release
`At3g47760`	ABC transporter A family member 5.	No verified direct reference in this release
`At3g47770`	ABC transporter A family member 6.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_031362 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0005739 mitochondrion Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0016020 membrane Cellular Component

GO:0005319 lipid transporter activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

GO:0042626 ATPase-coupled transmembrane transporter activity Molecular Function

GO:0140359 ABC-type transporter activity Molecular Function

KEGG gene cross-reference

ath:AT3G47740

ath:AT3G47750

ath:AT3G47760

ath:AT3G47780

ath:AT3G47790

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.353

Rank 1 · TkAUNG047480 · TK1151

Lysosome / Vacuole0.332

Rank 2 · TkAUNG047480 · TK1151

Cytoplasm0.212

Rank 3 · TkAUNG047480 · TK1151

Golgi apparatus0.168

Rank 4 · TkAUNG047480 · TK1151

Endoplasmic reticulum0.165

Rank 5 · TkAUNG047480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12698ABC2_membrane_350-329 aa

PF22874SBE2_M340-431 aa

PF00005ABC_tran426-562 aa

PF13476AAA_23436-453 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkAUNG047480	`PF12698`	ABC2_membrane_3	50	329	4.8e-14	53.0
TkAUNG047480	`PF22874`	SBE2_M	340	431	0.016	16.1
TkAUNG047480	`PF00005`	ABC_tran	426	562	9.1e-21	75.6
TkAUNG047480	`PF13476`	AAA_23	436	453	0.26	12.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9STT5`	Arabidopsis thaliana	sp\|Q9STT5\|AB7A_ARATH ABC transporter A family member 7	70.000%	Swiss-Prot	High
`Q8LPK0`	Arabidopsis thaliana	sp\|Q8LPK0\|AB8A_ARATH ABC transporter A family member 8	67.700%	Swiss-Prot	High
`Q1PEH6`	Arabidopsis thaliana	sp\|Q1PEH6\|AB3A_ARATH ABC transporter A family member 3	67.700%	Swiss-Prot	High
`Q9STT7`	Arabidopsis thaliana	sp\|Q9STT7\|AB5A_ARATH ABC transporter A family member 5	66.400%	Swiss-Prot	High
`Q9STT6`	Arabidopsis thaliana	sp\|Q9STT6\|AB6A_ARATH ABC transporter A family member 6	65.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card